KEGG   Labrenzia sp. CP4: ACP90_17285Help
Entry
ACP90_17285       CDS       T04295                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
lap  Labrenzia sp. CP4
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lap00001]
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ACP90_17285 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ACP90_17285 (alr)
Enzymes [BR:lap01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ACP90_17285 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:lap01011]
 Precursor biosynthesis
  Racemase
   ACP90_17285 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3759257..3760399
Genome map
AA seq 380 aa AA seqDB search
MPATIEQAFPSNLYGGRLTIDLDAIVSNWSLLKGKVSDSTDCAAVLKADAYGTGQDKTAA
ALYQAGCRTFFVAVPTEALTLRASLPDAVIYVLDGLFPGTADHFLTHDIRPVLGSLEELL
EWAEVCKASGKNNAAAVHVDTGIHRLGLSPAELTRALGDNTVLGPFQPSLVMSHLACGST
PDHDMNRRQLKLFTETTAPFPHIPRSLANSAGVLLGPDYHFDLVRPGIALYGGLAIETEP
NPMKPVAKVEARIMIVRDVPQGDTIGYGAKQTAKRPLRNAVVAAGYADGMIRRAGSTDDR
PGGFGLIGGYKAPILGRISMDMITLDVTDVPEHLLQRGAFVEMLGPGVAASDLAAYAETI
DYEYLTSLGRRFERVYAPLT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgcgacgattgaacaagctttcccatccaatctttacggcggacgactgacgatc
gaccttgatgcgatcgtgtcgaactggtccttgctgaaaggcaaggtaagcgacagcacc
gattgcgctgccgttctgaaggccgatgcctatggaaccggacaggacaaaaccgctgca
gccctctaccaggcgggatgcaggacgtttttcgtcgcggtgccgaccgaggccctgacg
ttgcgcgcaagtcttccggacgccgtcatctacgtgctcgacgggctgtttccgggaacg
gccgaccactttctgacccatgacatccgtcccgtcctcggcagtctggaagaactcctg
gaatgggcggaagtctgcaaggcgtcgggcaagaacaatgccgccgctgtccatgtcgat
accggcatccaccgtttgggcctgtctccggctgaactcacccgcgctctgggtgacaac
accgttctggggccgttccagccatcactggtgatgagccatcttgcctgtggctcgaca
cccgaccacgacatgaaccggcggcagctcaagctgtttacggagacaaccgcccccttc
cctcacattccgcggtcattggcaaattccgccggggtgctgcttggcccggactaccac
ttcgaccttgtccgtcccgggatcgcgctttacggcgggctggccatcgaaaccgagccc
aacccgatgaaaccggtcgccaaggtggaagcacgcatcatgatcgtgcgcgacgttcca
cagggcgataccatcggctatggcgcgaaacaaaccgcaaagcgccccttgcgcaatgcc
gtcgtggctgccggttatgccgacggcatgatccgtcgtgccggctctacggacgaccgc
ccgggtggcttcgggctgatcggcggatacaaggcgccgatcctcggccggatttcaatg
gacatgatcacgctcgacgtgacggatgtgcctgaacacctgcttcagcgcggcgcgttt
gtggaaatgctggggccaggtgttgcagcttccgatcttgccgcttatgcggaaaccatc
gactacgaatatctgacaagcctcggacgtcggtttgagcgcgtctatgcgcccctgacc
tga

DBGET integrated database retrieval system