KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_777Help
Entry
GLA29479_777      CDS       T04526                                 

Definition
(GenBank) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
laq  Lysobacter antibioticus ATCC 29479
Brite
Enzymes [BR:laq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     GLA29479_777
Peptidases [BR:laq01002]
 Metallo Peptidases
  Family M2
   GLA29479_777
Exosome [BR:laq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GLA29479_777
CD molecules [BR:laq04090]
 Proteins
  GLA29479_777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
820193..822223
Genome map
AA seq 676 aa AA seqDB search
MNHVRAVLALGIAAAVIGLAGCKKDPTPSSSTTAAAAPEGETADQFIARVNDEYKKMYPE
MTSAQWLSSTYINDDSQLLSAKANERYLTQLNSWIEQSKKFEGQQMSPASARAIQLLKIG
TSMPAPKDPAKLAELTQIATRMEGMYGSGTYCSGTGDTDCRQLGDLEDVLRNSRDYDAQL
DAWKGWHTISKPMRKDYTRFVELVNEGARNLGYADTGELWRSGYDMSPVELAAETDRLWG
QVKPLYEQLHCYTRSRLEAKYGADKGETTGGMLPAHLLGNMWQQDWGNMWDVLAPYTEQQ
AGSLDINGALARQYQHNFDLQTAKNPGDRAADEQAQIEVDANLANAKQMTERAQDFYVSL
GMPKLPDSYWSKTQFIKPRDRDVVCHASAWDMNMGGDVRTKMCIKPNEEDFTTIYHELGH
VYYYLAYNNQPPLFQTGAHDGFHEAIGDTIVLAMTPKYLQSIGLVGSQQQSNESLINAQM
RMALAKVSFLPFGLMIDRWRWGVFDGSIKPGEYNKAWWELKAKYQGVAPVEARGEEFFDA
GAKYHVPGNTPYTRYFLSHVLQFQFYKSLCDAAGFKGPLYECSFYGNKAAGAKFQAMLSK
GASQPWQQTMKELTGGEKMDASAVLEYFAPLQTWLKQQNEGQSCGWQASAAGAPAPAGAK
PAAAKPEAKAGKPAQG
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgttcgcgccgtattggcgctcggcatcgctgcggccgtcatcggcctggcc
ggatgcaagaaagaccccaccccctcctccagcaccacggccgccgccgcgccggaaggc
gagaccgccgaccagttcatcgcccgcgtcaacgacgaatacaagaagatgtatccggag
atgacctcggcacagtggttgtcctcgacctatatcaacgacgacagccagctgctctcg
gccaaggccaacgagcgctacctgacccagctcaacagctggatcgaacagtcgaagaaa
ttcgaaggccagcagatgtcgcccgccagcgcgcgcgcgatccagttgctgaagatcggc
acctcgatgccggcgccgaaagacccggccaagctcgccgaactgacccagatcgccacg
cgcatggaaggcatgtacggctcgggcacgtattgcagcggcaccggcgacaccgattgc
cgccagctcggcgatctcgaagacgtgctgcgcaacagccgcgactacgacgcccagctc
gacgcatggaagggctggcacaccatctccaagccgatgcgcaaggactacacgcgcttc
gtcgaactggtcaacgaaggcgcgcgcaacctcggctatgccgacaccggcgagctgtgg
cgctccggctacgacatgagcccggtcgagctcgccgccgaaaccgaccgtctctggggc
caggtcaagccgctgtacgaacaactgcactgctacacccgctcgcgcctggaagccaag
tacggcgccgacaagggcgagaccaccggcggcatgctgccggcgcacctgctcggcaat
atgtggcagcaggactggggcaacatgtgggacgtgctggcgccgtacaccgagcagcag
gccggcagcctcgacatcaacggcgcgctggcacgccagtaccagcacaacttcgacctg
cagacggcgaagaaccccggcgaccgcgccgccgacgaacaggcgcagatcgaagtcgac
gccaacctggccaacgccaagcagatgaccgagcgcgcgcaggacttctacgtctcgctc
ggcatgcccaagctgcccgacagctattggagcaagacccagttcatcaagccgcgcgac
cgcgacgtggtctgccacgccagcgcctgggatatgaacatgggcggcgacgtgcgcacg
aagatgtgcatcaagccgaacgaagaagacttcaccacgatctaccacgagctcggccac
gtctattactacctggcctacaacaaccagccgccgttgttccagaccggcgcgcacgac
ggcttccacgaggccatcggcgacaccatcgtgctggcgatgacgccgaagtacctgcag
tcgatcggcctggtcggcagccagcagcagagcaacgagtcgctgatcaacgcgcagatg
cgcatggccctggccaaggtctcgttcctgccgttcggcctgatgatcgaccgctggcgc
tggggcgtgttcgacggctcgatcaagccgggcgagtacaacaaggcctggtgggaactg
aaggccaagtaccagggcgtggccccggtcgaggcgcgcggcgaagagttcttcgacgcc
ggcgccaagtaccacgtgccgggcaatacgccgtacacgcgttacttcctctcgcacgtg
ctgcagttccagttctacaagtcgctgtgcgacgcggccggtttcaagggcccgctgtac
gagtgcagcttctacggcaacaaggccgccggcgcgaagttccaggcgatgctgagcaag
ggcgccagccagccttggcagcagaccatgaaggaactgaccggcggcgagaagatggat
gcctcggcagtgctcgaatacttcgcgccgctgcagacctggctcaagcagcagaacgaa
ggccagagctgcggttggcaggcttcggcggcaggcgcgcccgcgccggccggcgccaag
ccggcagcggccaagcccgaggcgaaggcaggcaagcccgcacaaggctga

DBGET integrated database retrieval system