KEGG   Candidatus Liberibacter asiaticus Ishi-1: CGUJ_01090Help
Entry
CGUJ_01090        CDS       T03607                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
lat  Candidatus Liberibacter asiaticus Ishi-1
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lat00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CGUJ_01090
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CGUJ_01090
Enzymes [BR:lat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CGUJ_01090
Peptidoglycan biosynthesis and degradation proteins [BR:lat01011]
 Precursor biosynthesis
  Racemase
   CGUJ_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
220201..221313
Genome map
AA seq 370 aa AA seqDB search
MHSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDF
FVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGV
SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLE
RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEA
RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG
FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR
IGTRYAKFYT
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaaatgaatttctaagacttaaaattgatcttacagccctgaaaaataattgg
catagtatgaatgcactttctggtaacgcacgaacagcagcagtagtgaaggacaatgca
tatgggttgggttgtgaaaagatagctccagccctctacaatgctggagtgcaagatttt
tttgtgactagtgtagaagaaggagtaaaacttcgtctatataccccacaagcaagaatt
tttgttttatatggtatacatccaggacaagaaaaaattatatttgacacaaatctcata
cctgttatctcttctgttcctcaactgactttttattcaaagttaatgtcttgtggcgtt
tcacatccctacgctttacaagttgatacaggcttcaataggttaggactctctctacaa
gaagcattagattttacacacaattcttttaataaaaaattaggtcagttatctctcatc
ataagtcatcttgcttgtgctgatgacccgagttctcatgttaattctgtgcaattagaa
agatttcgtactcttatctcacattataagggaatagaagcaagtttagcctcttcatca
ggaattttactcggtccaaattatcattttcaattaactcgccctggaatatccctatat
ggcggaactgataaaatcaataagtcgcatcctatgcaaactgttgtcactgcagaagca
cgtattattctcatccgcaaagcattggcaggagaattagttagctatggaggacaaaaa
aaattaacacgcgatagtctgatagccgttgcagccattggatatgccgatggctatcct
ttaaccctttctggattagattcagaacacagtccatctgtatttctaggagggaaagga
tttatcaaaggttatatggttcccattttagggaaaataacaatggacatgacaatgttt
gacattaccgattctcttagcatagaagtaggagattatatccagatttttggacctgat
ataaaattagatgatgtagcccttgcttctggaactactaattatgatcttcttgtgaga
attggaacgcgttatgcaaaattttatacataa

DBGET integrated database retrieval system