KEGG   Loxodonta africana (African savanna elephant): 100653780Help
Entry
100653780         CDS       T04351                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lav00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100653780 (SUV39H1)
Enzymes [BR:lav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100653780 (SUV39H1)
Chromosome [BR:lav03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100653780 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100653780 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 452 aa AA seqDB search
MAQRAQGPGIRGHGAGSWKPGVERMGLGERGPGARGWAGLWEGARVSERGRRGVKGGRGM
GRAWERVLQVATGPVRVPAGDRPGGRTRARDYGPPEQEYYLVKWRGYPDSESTWEPRQNL
KCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQKAKQRRALRRWEQELNAKRS
HLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVGCECQDCLWAPAGGCCPGASL
HKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKGIRYDLCIFRTADGRGWGVRT
LEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAYYGNISH
FVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEELTFDYNMQVDPVDMESTRMD
SNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcgggctcaggggcccggcatccgaggccacggagccggcagctggaagcct
ggcgtggaaaggatggggctcggggagcgcgggcctggtgcgcggggctgggcggggctg
tgggaaggggcgcgtgtctccgaacgtggccggcgcggggtgaagggcgggcgcgggatg
gggcgggcgtgggagcgcgtgctccaggtcgcgactggaccggtgcgcgtacccgcaggg
gatcgtccgggaggccgaacccgcgcgcgggactatgggcctccggaacaggagtattac
ctggtaaagtggcgtggatacccagactcagagagcacctgggagccacgacagaatctc
aagtgtgtacgcattctcaagcagttccacaaggacttagaaagggagctgctccggcga
caccaccggtcaaagccacctcggcacttggacccaagcttggccaactacctggtgcag
aaggccaagcagaggcgggcactgcggcggtgggagcaggagctcaatgccaagcgcagc
cacctgggacgcatcacagtggagaacgaggtggacctggacgggcctcctcgggccttt
gtgtacatcaatgagtaccgtgttggtgagggcatcacgctcaaccaggtggctgtgggc
tgcgagtgccaggactgtttgtgggctcctgctggaggctgctgtccaggggcatcactg
cacaagtttgcctacaacgaccagggccaggtgcggctgcgagccgggctgcccatctac
gagtgcaactcacgctgccgctgcggctatgactgccccaatcgcgtggtacagaagggc
attcgctacgacctctgcatcttccgcacagctgatggccgtggctggggcgtccgcaca
ctggagaagatccgcaagaacagctttgtcatggagtacgtgggagagatcattacctca
gaagaggcggagcggcggggccagatctatgaccgtcagggcgccacctacctcttcgac
ctggactatgtggaggatgtgtataccgtggatgccgcctactatggcaacatttcccac
tttgtcaaccatagttgtgaccccaacctgcaggtgtacaatgtcttcatagacaacctt
gatgagcggctgccacgcatcgcgttctttgccacaaggaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggctgggctccctggctccccaaagaagcgggtccgtattgaatgc
aagtgtgggactgaatcctgccgcaaatacctcttctaa

DBGET integrated database retrieval system