KEGG   Loxodonta africana (African savanna elephant): 100661555Help
Entry
100661555         CDS       T04351                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:lav00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    100661555
   04614 Renin-angiotensin system
    100661555
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100661555
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100661555
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100661555
Peptidases [BR:lav01002]
 Metallo Peptidases
  Family M2
   100661555
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100661555
CD molecules [BR:lav04090]
 Proteins
  100661555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 820 aa AA seqDB search
MGRRWTCPRPFLLVLLCYGQLLSWLRTGDTQSPDMSYNESEAKEFLQNYEQTAQFVWNNF
MEATWNYVTNITKKNREEMLLKDMERSQHILYFGTQARLFNITTFQDPVIKRMLRKVQNM
GKAVLPVEELQEYNQLLAYMKTMYSMAEVCLEEGPCLYLEPDLEEVMATSRDQKELLWAW
QGWRDAAGRPLRTFFERYVQLSNKAANLNGYKDMGALWRSKYDSENETSTLEGDLELLFQ
ELQPLYLNLHAYVRRALYRHYGPQLIDLKGPIPAHLLGDMWAQSWVNILDLVLPFPEKPL
EDITKIMKGQRWKPHKMFQEAEKFFTSLGLLPAPMEFWSKSMLEKPADGREVMCHASAWD
FYNGHDFRIKKCTEVSIEDLLSVFHLMGHIQYFLQYKSLSVIFREGANPAFEEAVGSAIT
LSASSHKYLLNIGLLSLVFQDSKDEVNFLMGIALEKIAFIPFGYLVDLYRWKVFDGTIHK
DIYTQEWWRLRLKYQGLCPPIPRSEEDFDPGAKYHISASIPYLRYFLSVVLQFQLHEALC
RAAGHMGPLHRCNIYNSKMAGKLLEDALKLGSSKPWPEVLKMLTGESHVSTKALMTYFKP
LMNWLVTENVRQGEVLGWPEFSCSFEEKEKSTFLGLELDSDQAKMGQWVLLVLSLVMFLM
VLILGRRLYTLSTAQDTEAYFLGMAMEPNKAARGQWILLGLCVLLLVCSISLTIKIFTQY
SKKPPWMTADWPRTTAPPPTSQDPPLPGPVQEKLPPPRPASPQPPPPPPTPLVSAPWRGQ
FPVGLGWEEVRGAVTGEGGEAKAGGRGTMLVGSPPGAAPT
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaagatggacttgccctcgacctttcctgcttgtgctcctctgttacggacag
ctcttgtcatggctcaggactggggatactcagagcccagatatgtcctacaacgagagt
gaagcaaaggaattccttcagaattatgaacaaacagcccagtttgtatggaacaacttc
atggaggctacctggaactatgtcaccaacatcaccaagaaaaaccgagaggagatgctg
ctcaaagacatggagagatcccagcatatcctatactttggcacccaagcccgcctgttt
aacatcaccacattccaggacccagtcataaagcgcatgctgagaaaggtccaaaacatg
ggcaaggcagttctgcctgtggaagaactccaggagtacaaccagctcctggcctacatg
aagacgatgtacagtatggcggaggtgtgccttgaagaggggccctgcctgtacctggag
cctgaccttgaagaagtgatggccacctcccgggaccagaaagagctgctgtgggcgtgg
cagggctggcgggacgctgcaggccgcccactccgcaccttcttcgagcgctatgtgcaa
ctcagcaacaaggccgcaaacctcaatggttacaaagacatgggggccttgtggcgctca
aagtatgactctgagaatgagaccagcaccctggaaggcgacctggagctgttgttccag
gagcttcagccgctgtacctgaacctgcatgcctacgtgcgccgtgccttgtaccgccat
tatgggccccagctcatcgacctgaaggggcccatccccgcccacctcctgggggacatg
tgggctcagtcctgggtcaacatcttagacctggtcttgcccttcccggagaaacccctg
gaggacatcacgaagatcatgaaaggccagcgctggaagccccacaaaatgttccaagag
gctgaaaaattcttcacctcccttgggctactgcctgccccaatggaattctggagcaag
tcgatgctggagaagccagctgatgggcgggaggtgatgtgccatgcttctgcctgggac
ttctacaatggtcacgacttcaggataaagaagtgtaccgaggtgagcatagaagacctg
ctctccgtcttccacctaatgggccatattcagtactttctgcagtacaagagcctttct
gtgatcttccgagaaggtgccaacccagcctttgaagaggctgtggggtcagcgatcacc
ctctcagcctcctcccacaagtacctgctcaacataggcttgctcagcttagtgttccag
gactcaaaggacgaggtcaatttcctgatgggcattgccctggagaagattgccttcatc
ccctttggctacctggtggacctgtaccgctggaaggtatttgatggcaccatccataag
gacatctatacccaggagtggtggcgcctgaggttgaagtaccagggcctgtgccccccc
attcctcggtcagaagaggactttgatccaggtgccaagtaccacatttctgccagcatt
ccctacttaaggtactttctcagcgtggtgctccagttccagctccatgaagcactgtgc
agagccgccggccacatgggtccgctgcaccggtgtaacatctataactccaagatggct
ggaaagctcctagaggatgctctaaagctgggttcaagcaagccctggccagaagtcctg
aagatgctgaccggggagtcccacgtgtctacaaaggccctcatgacctacttcaagccc
ctgatgaactggctggtcaccgagaatgtgcggcagggggaggtcctgggctggccagaa
ttcagctgttcctttgaagaaaaagagaagagcacattcctgggtctggagctggacagt
gaccaggccaagatggggcaatgggtgctgctggtcttgagccttgtcatgttcctcatg
gttctaatactgggccgcaggctatacactctgtcaacagcccaggacactgaggcttac
ttcctgggcatggccatggagcccaacaaggctgcccggggccagtggatattgctgggc
ctctgtgtcctcctgctggtgtgctcaatcagcctgaccatcaagattttcacacagtac
agcaagaagcccccatggatgacagctgactggcccaggaccaccgccccgccccctacg
agtcaggacccgcccctgcccggtccagtccaggagaagttgcccccaccccgcccggcc
tccccgcagccgccgccgccgccgcccacacctcttgtttcagcaccgtggcgcggacag
ttcccggtcgggctaggttgggaggaggtgcggggagcggtgaccggggagggcggggag
gccaaggcaggcgggcggggcacgatgctcgtcggctctcctcctggggcggcgcctacc
tag

DBGET integrated database retrieval system