KEGG   Loxodonta africana (African savanna elephant): 100666671Help
Entry
100666671         CDS       T04351                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lav00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100666671 (ABAT)
   00650 Butanoate metabolism
    100666671 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100666671 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    100666671 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100666671 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    100666671 (ABAT)
Enzymes [BR:lav01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100666671 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100666671 (ABAT)
Amino acid related enzymes [BR:lav01007]
 Aminotransferase (transaminase)
  Class III
   100666671 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MASRLLTRQLASSLQHNYRLLMPGSRHIGQASAKVDMEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQIASVPIGYSHPALMKLLQQPQ
NVNTFVNRPALGILPPGDFVEKLRESLLSVAPKGMSQIITMACGSCSNENAFKTIFMWYR
NKERGHTEFSKEELETCMINQAPGCPDYSILSFMGAFHGRTLGCLATTHSKAIHKIDIPS
FDWPIAPFPWLKYPLEDFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFWKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADLMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINVIKREDLLNNAAHAGKTLLTGLL
ELQARYPQFISRARGRGTFCSFDTPDESIRNKLILIARNKGVVLGGCGNKSIRFRPTMVF
RDHHAHLFLNIFSDILANFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaggctgcttacccggcagctggcctccagcctccagcacaactaccgcctg
cttatgcccgggtccagacatatcggtcaggcctcagccaaagtcgatatggagtttgat
tacgatgggcctctgatgaagacggaagtcccggggcctcggtctcgggagttaatgaaa
cagctgaatataattcagaatgcagaggctgtgcattttttctgcaactatgaagagagc
cgaggcaactacctggtcgacgtggatggcaatcggatgttggatctttactcacagatc
gcctctgtccccataggttacagccaccctgctctcatgaaactcctccagcagcctcaa
aatgtgaacactttcgtcaacaggcctgctctcggcatcctgcctccaggggacttcgtg
gagaaactcagggagtccttgctctcggtggctcccaaagggatgtcccagatcatcacc
atggcctgcggctcctgctccaatgagaacgccttcaagaccatcttcatgtggtaccgg
aacaaggaaaggggtcatacagagttctccaaagaggagctggagacctgcatgatcaac
caggcccccgggtgtcccgactacagcatcctctccttcatgggcgcattccatgggagg
accttgggttgcttagcgaccacgcactccaaagctattcacaagattgacatcccttcc
ttcgactggcccattgcaccattcccatggctaaaataccctctggaagacttcgtgaaa
gagaaccaacaggaagaggcccgctgcctggaagaggtggaggatctgattgtgaaatat
cggaaaaagaagaagacagtggctgggatcattgtggagcccatccagtctgagggtggg
gacaaccacgcctccgatgacttcttctggaagctgagagacatcgccaggaaacatggc
tgtgcgttcctggtggatgaggtccagacgggagggggctgcaccggtaagttctgggcc
cacgagcactggggcttggatgacccagctgacctgatgaccttcagcaagaagatgatg
accgggggcttcttccacaaggaggagttccggcccaatgctccttaccggatcttcaac
acctggctgggggacccgtccaagaacctgctgctggccgaggtcatcaacgtcatcaag
cgggaggacctgctgaataacgcagcccatgccgggaagaccctgctcacggggctgctg
gagctccaggcccggtacccccagttcatcagccgagcgagaggacgaggcaccttctgc
tccttcgacactccagatgaatccatacggaataaactcattttaatagccagaaacaaa
ggtgtggtgttggggggctgtggcaacaaatccatccgtttccgtcctaccatggtcttc
agggatcaccatgcgcacctgttcctcaatattttcagcgacatcttagccaacttcaag
taa

DBGET integrated database retrieval system