KEGG   Loxodonta africana (African savanna elephant): 100670373Help
Entry
100670373         CDS       T04351                                 

Definition
(RefSeq) anionic trypsin-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:lav00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100670373
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100670373
   04974 Protein digestion and absorption
    100670373
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100670373
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100670373
Peptidases [BR:lav01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100670373
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100670373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MNPLLILALVGTAVSLPTKDDDDKIVGGYTCKENSVPYQASLNSGYHFCGGSLINDQWVV
SAAHCYKYRIQVRLGEYNIDVLEGNEQFISTAKTIRHPQYDSKTLDNDILLIKLSSSAVI
NSQVSPVALPSGCASAGTWCLISGWGNTLSSGVNYPELLQCLDAPLLSQADCEASYPGEI
TENMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQENLPGVYTKVCNYVNWI
QDTIAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttgccctggtgggcactgctgtctctctccccacaaaagac
gatgatgacaagattgtcgggggctacacctgcaaggagaattctgtgccctaccaggcg
tccctgaactctggctaccacttctgtggcgggtccctcatcaacgaccagtgggtggta
tccgcagcccactgctacaagtaccgcatccaagtgaggctgggtgagtacaacatcgac
gtcctcgaggggaatgagcagttcattagcacagccaagaccatccgccaccctcagtat
gacagcaagaccctggacaatgacatcttgctgatcaagctgtcctcaagtgcagtcatc
aactcgcaggtgtcgccagtggccctgccctcaggctgtgcttctgctggcacctggtgc
ctcatctctggctggggcaacaccctcagctctggggtgaactaccctgagctgctgcag
tgcctggatgccccactgctgagccaggccgattgcgaggcctcctaccccggggagatc
actgagaacatggtctgcgccggctttctggagggaggcaaggactcctgccagggtgac
tccggcggccccgtggtctgcaatggagagctgcagggcatcgtgtcctggggctatggc
tgtgcccaggagaacctgcctggtgtctacaccaaggtctgcaactacgtgaactggatc
caggacaccattgctgccaactga

DBGET integrated database retrieval system