KEGG   Loxodonta africana (African savanna elephant): 100676143Help
Entry
100676143         CDS       T04351                                 

Gene name
TGM3
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100676143 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core Topo_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 100676143
NCBI-ProteinID: XP_003411669
LinkDB All DBs
Position
Unknown
AA seq 681 aa AA seqDB search
MNWNVSSNRQAHHTDKFYSPELILRRGQLFTVSLGFRENVGSGQNLTFTVSTGPNPSESA
KTKAVFQLSNGKSGGWSAELQANRGNTLTISISSPANAPIGRYTLSLQSSFFSGQLGTFI
LLFNPWLQADDVFMSNAAEREEYVQQDAGIIYVGSTNRISMVGWNFGQFEQDILSICLSI
LDKSLNFRRDPANDVAQRNDPKYVGRVLSAMINSNDDNGVLAGNWSGSYPGGRDPRNWNG
SVEILKEWKRSSFKPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSAHDTDQNLSVDVY
YDPRGNPLDRGSDSIWNFHVWNEAWFTRTDVGPSYSGWQVLDATPQERSQGVFQCGPASV
IGIREGEVDQDFDMPFVFAEVNADRNTWIYDSTTNTQMKSSSESSSVGKYISTKAVGTNS
RMDVTEKYKYPDGSAQERQVFQKALEKLRPNLLFRATSAESSERDVQKPSISGKFKVTGL
LVVGQEVNLALNLKNLASGRKTMTVNMTAWTIVYNGTLVHEVWKDSFTISLDPGEETQHP
VKISYAQYEKYLKADNMIRITAVCQVPSEGDVVVARDIILDNPSLTLEALGEARVQKPVN
VQMLFSNPLDEPVKNCVLMVEGSGLLRGNLKIDVPNLRPKERSHVRFEILPTRSGTKQLL
ADFSCNRFPAIKSILPIDVAE
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaacgtgtcctccaaccggcaagcgcatcacacagacaagttctacagcccg
gaactgatcttgcggagaggccaactcttcacagtctcattgggcttccgggaaaatgtg
ggctctggacaaaatctgacgttcacagtctccacagggcctaacccctcagagtctgcc
aagacgaaggctgtgtttcaactctccaatggaaaaagtggtggctggagtgcggagctc
caggccaaccggggcaacactctgaccatcagcatctccagtcctgccaacgcacccata
ggacggtacacgctgagccttcagagctccttcttctctgggcaacttggaacgttcata
ctcctctttaatccctggcttcaagcggatgatgtctttatgagtaatgctgctgagaga
gaggagtacgttcaacaagatgccggcatcatctatgtgggaagcacaaatcgcattagc
atggttggctggaactttggacagtttgagcaggatattctgagcatttgcctctcgatc
ctcgataaaagtctgaatttccgccgtgaccccgctaatgacgtggcccagagaaatgac
cccaaatatgttggccgggtgctcagtgcaatgatcaacagcaatgatgacaacggtgtg
cttgctgggaattggagtggcagctacccgggtggccgggacccaaggaactggaacggc
agcgtggagatcctcaaggagtggaaaagatccagcttcaagcctgtgcgctatgggcag
tgctgggtctttgctggaaccctcaatacagcattgcggtctcttgggattccctcccga
gtgatcaccaacttcaactcggctcatgacacagaccaaaacctcagtgtggatgtgtac
tatgaccccaggggaaaccctctggacagaggcagtgacagcatatggaatttccatgtc
tggaatgaagcctggtttacccggacggacgtgggtccctcatacagtggatggcaggtg
ttggatgcaactccccaggaaaggagccaaggggtgttccagtgtggccctgcctcagtt
atcggtatccgagagggtgaagtggaccaggactttgacatgcccttcgtctttgcggag
gtgaacgccgaccgcaacacctggatctatgacagtaccaccaacactcagatgaagagt
tcctctgagtcgagctccgtgggcaagtacatcagcaccaaggctgtgggcaccaactcc
cgcatggacgtcacggagaagtacaagtaccccgacggttccgctcaggaaagacaagtg
ttccaaaaggctctggagaaacttagacccaacctattgttcagggcaacatctgcagag
agctcggaaagagacgttcagaagcccagtatctctgggaagttcaaggtcactggtctt
ctggtagtgggccaggaagtcaacctggccctgaatttgaaaaacctggcaagtggtagg
aagacgatgacggtgaacatgacagcctggaccattgtctacaatggcacgctagtacat
gaggtgtggaaggactccttcaccatttctctggaccccggagaagaaacgcagcacccc
gtaaagatctcatacgctcagtacgagaagtacctgaaagctgacaacatgatccgcatc
acagccgtgtgccaggtccccagcgagggtgatgtggtggtagcacgggatatcatcctg
gacaacccttccctgactcttgaggcgctgggtgaggcacgggtgcagaagcctgtgaac
gtgcagatgctgttctccaaccccctggacgaacccgtgaagaactgtgtgctgatggtg
gaggggagcggcctgctgcggggcaacctcaaaatcgacgtgccaaacctgcgccccaag
gagcggtcccatgtccgttttgagatcctgcccacccggagtggcaccaagcagctgctc
gctgacttctcctgcaacaggttccctgcaatcaagtccatattgcccatcgacgtggct
gagtga

DBGET integrated database retrieval system