KEGG   Leclercia adecarboxylata: APT61_12585Help
Entry
APT61_12585       CDS       T04232                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lax  Leclercia adecarboxylata
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lax00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    APT61_12585
Enzymes [BR:lax01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     APT61_12585
Transporters [BR:lax02000]
 Other Transporters
  Pores ion channels [TC:1]
   APT61_12585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2698427..2699032
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLNGVDLMKKRLENGDDFFAVNPKGQVPALLLEDG
TLLTEGVAIMQYLADGVADRQLLAPTGSIARYKTLEWMNYIATELHKGFTPLFRPDTPEE
YKPTVRALLEKKLQYVNESLKDDQWICGPRFTIADAYLFTVLRWARAVKLNMEGLSHIDA
YMQRMAERPAVAAALEAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaaccaggcgcctgctctcttgcctcccatattacgctgcgcgag
agcggtaaagacttcacgctcaacggtgttgatctgatgaaaaagcgtctggaaaacggc
gatgattttttcgcggtgaatcctaaaggccaagtcccggcactgctgctggaagatggc
accttactgaccgaaggggtagctatcatgcaatacctggcggatggcgtcgcggatcgc
cagctgctggccccgaccggcagcatcgcccgctataaaactctcgaatggatgaactac
atcgccactgaactgcacaaaggtttcaccccgctgttccgcccggataccccggaagag
tacaagccgaccgttcgtgctctgctggagaaaaagctgcaatacgtgaacgagtcgtta
aaagacgatcagtggatttgcggcccacgctttaccattgccgatgcgtatctgtttacc
gttctgcgctgggcgcgggccgtgaagctgaatatggaagggttaagccatattgacgcc
tatatgcagcgtatggcggagcgccctgccgtggcggcagcgctggaagcggaaggtttg
aagtaa

DBGET integrated database retrieval system