KEGG   Laccaria bicolor: LACBIDRAFT_300718Help
Entry
LACBIDRAFT_300718 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
lbc  Laccaria bicolor
Brite
Translation factors [BR:lbc03012]
 Eukaryotic Type
  Elongation factors
   LACBIDRAFT_300718
 Prokaryotic Type
   LACBIDRAFT_300718
Mitochondrial biogenesis [BR:lbc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    LACBIDRAFT_300718
Exosome [BR:lbc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LACBIDRAFT_300718
  Exosomal proteins of breast cancer cells
   LACBIDRAFT_300718
  Exosomal proteins of colorectal cancer cells
   LACBIDRAFT_300718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 6069209
NCBI-ProteinID: XP_001873223
JGI: 300718
UniProt: B0CQ61
LinkDB All DBs
AA seq 441 aa AA seqDB search
MLPLATCKAVSRGLTAARSSLLLACQRSPRSGIPSFALCRGYAEQFSRSKPHMNIGTIGH
VDHGKTTLTAAITKVLSTQGGAKFTDYSQIDKAPEEKARGITINSAHVEYETATRHYGHI
DCPGHADYIKNMITGAAQMDGAIIVVSATDGQMPQTREHLLLARQVGIKRLVVFINKVDQ
ISDPEMLELVDMEMRDLLTTYNFDGESTPIIMGSALAALEGRNDDIGATKIQELVNACDE
WLELPLRDLEKPFLMPIEDVFSISGRGTVATGRVERGIALKGSDVEVVGFGANFKTTLTG
IEMFHKELDRAEAGDNMGALLRGIKREQIRRGHVLAAPGSVKAAKKFLAQIYVLTKDEGG
RYTPFMSNYRPQCFIRTADITVALTFPEGTPDAAEKMVMPGDNVELVCDLYFDVALEEGT
RFTLREAHKTIGTGIVTKILE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctctcgcaacttgcaaagctgtatctcgtggtttaaccgcggcacgttcatcc
ttgctgttggcttgtcaacgtagccccaggtcgggtattcccagctttgctctttgcaga
ggctatgcagaacaattttcgcggtccaagcctcatatgaacattgggaccattggccat
gtcgatcacgggaaaacaacattgaccgccgccattaccaaggttctttctacacagggt
ggagcaaagtttaccgactacagccagatcgacaaggccccagaggagaaagctcgaggt
atcactatcaactctgctcacgttgaatacgagacagcgacacgccactacggtcacatt
gattgcccgggtcacgctgattacatcaaaaacatgattaccggcgccgcacaaatggac
ggcgctatcatcgttgtttctgccactgatggccaaatgcctcagactcgtgaacatttg
ctattggcgcgtcaggttggcataaaacggctggttgttttcatcaacaaagttgaccaa
atctcggaccctgaaatgcttgaacttgtggatatggaaatgcgcgacctcttgaccacg
tataacttcgacggcgaatcaaccccaattattatgggatcggctttggctgcactggaa
ggacgcaacgacgacatcggcgctacgaagattcaggaattggtcaatgcttgtgatgaa
tggctcgaactccctcttcgtgatctcgagaagcctttcctgatgcccatagaagacgta
ttctcgatttccggacgtggtactgttgcaaccggtcgtgttgaacgcggaatcgctctg
aaaggcagtgacgtagaagttgtcggttttggtgccaactttaaaactacgctgaccggg
attgaaatgttccacaaagaactggaccgagctgaagctggcgacaacatgggtgctctc
ctccgtggtataaagcgcgaacaaattcgccgtggtcacgttttggctgctcccggttca
gttaaagctgcaaagaagttcctggcccagatctacgtattgaccaaagacgaaggtggt
cgttatacgcccttcatgagcaactataggcctcaatgcttcatccgaacggccgatata
actgttgctcttacgtttcctgagggcacgcctgatgctgctgagaaaatggtcatgccc
ggtgacaacgttgagcttgtgtgcgacctttacttcgacgttgcgttggaagaaggaact
cgatttactcttcgcgaggcacacaaaacaattgggaccggaattgttaccaagattctt
gagtaa

DBGET integrated database retrieval system