KEGG   Leptolyngbya boryana: LBWT_24790Help
Entry
LBWT_24790        CDS       T04848                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
lbo  Leptolyngbya boryana
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:lbo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LBWT_24790
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    LBWT_24790
Enzymes [BR:lbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     LBWT_24790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2658669..2659016
Genome map
AA seq 115 aa AA seqDB search
MKTLPKEQRFETFSYLPPLTDAQIARQIQYTIENGFFPCIEFSESSAPEQYYWTMWKLPL
FNATSPQEVLNEVQQCRSEYSNCYIRVVAFDNIKQCQVMSFIVHKPGSGGSGYRY
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactctccctaaagagcagcgttttgaaacgttctcctacttgcctcctttgacc
gatgctcaaatcgctcgtcaaatccaatacacgatcgagaacggcttcttcccttgtatc
gagttcagcgagtcgtctgctcctgagcagtactactggacaatgtggaagttgcctttg
ttcaacgcaacttctcctcaagaagttctgaacgaagttcaacagtgccgttctgagtac
tcgaactgctacatccgcgtcgtagcattcgacaacatcaaacagtgccaagtgatgagc
ttcatcgttcacaaaccaggttctggtggaagcggctaccgctactaa

DBGET integrated database retrieval system