KEGG   Leptolyngbya boryana: LBWT_41620Help
Entry
LBWT_41620        CDS       T04848                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lbo  Leptolyngbya boryana
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lbo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBWT_41620
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    LBWT_41620
   00680 Methane metabolism
    LBWT_41620
Enzymes [BR:lbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LBWT_41620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4395581..4398643)
Genome map
AA seq 1020 aa AA seqDB search
MSSSRPSSSDESFASLATSADAIGEDVSALMSDLFLRHRLRIVEDLWEAVLQQECGQELV
DLLNQLRRMCSPEGQATTFTESDVLQVVENLDLNEAIRAARAFALYFQLINIVEQHYEQR
DQQLQYRMAREGQVEEVPKPSSPSSYATEEEAGRPEADFLERSLHEAASRREIGTFHWLF
PRLKQLNVPPQQIQRLIQQLDVSLVFTAHPTEIVRHTIRDKQRRIAKILRQLDSVEDSLK
AIGLSSSWETESLRDQLTEEIRLWWRTDELHQFKPTVLDEVDHALHYFREVIFEAIPHLY
TRLEQAVHQSFPRMEMPSRNFCQFGSWVGADRDGNPSVTPQVTWQTACYQRRIVLERYVQ
SVQCLTDLLSLSLHWSDVLPDLLESLEQDQQRMPDVYDRLSIRFRQEPYRLKLAYIQKRL
ENTLDRNHILYSGDGLQQEMPEFDEATLYRSGEDFLAELRLIQSNLAATGLSCRDLEHLI
CQVEIFGFCLAHLDIRQESPRHSETMNEIVEYLQVLPKAYNDMSEAERCEWLTRELQTRR
PLIPTEMPFSERTRETISTFRMVRKLQQEFGLEICRTYIISMSHDVSDLLEVLLFAKEAG
LYDPVTGLGTIQVVPLFETVEDLQKAPGIMKQVFAQPFYKALIAGGFDAIDKGTALQEVM
LGYSDSNKDSGFLSSNWEIHKAQQALQRIADEHGVALRIFHGRGGSVGRGGGPAYEAILA
QPGHSVNGRIKITEQGEVLASKYSLPELALYNLETVTTAVIQGSLLQNKFDEIAPWQQIM
EELAARSRTHYRQLIYEQADFIDFFHQVTPIEEISQLQISSRPARRGGKKDLASLRAIPW
VFSWTQSRFLLPSWYGVGTALNAFLDEAPEKHMQLLRHFYYKWPFFKMAISRVEMTLSKV
DLQIAGHYVQELTQAEDRERFAPVFEQIRQEYFLTRELVLKITGHNRLLDGDPELQRSVQ
LRNGTIVPLGFLQVSLLKRLRQHKTLAASGVVRSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgagccgaccctcttcttctgacgaatcatttgccagccttgccacttctgcg
gacgcaatcggtgaggatgtgagtgcgttgatgtccgatttatttttgcgccatcggcta
agaattgttgaggatctctgggaggcggtgctgcaacaagaatgcgggcaggaactcgtc
gatctgttgaatcagttgaggcggatgtgttcgccagaagggcaggcaacgacctttact
gaatcagacgtgctgcaagtggtggagaatctggatctcaatgaggcgatccgggcagcg
cgggcgtttgcgctttattttcagttgatcaatatcgtcgagcagcattacgagcagcgc
gatcagcagttgcagtatcggatggcacgggaaggacaggttgaagaagtgccaaaaccg
tcgtcacccagtagttatgccacagaagaagaagcgggacgaccagaagcggatttccta
gagcggagtctgcatgaagcggcgtctcgtcgagaaattggcacgtttcactggttgttt
cctcgtttgaagcagctgaatgtgccgcctcaacagattcaacggttgattcagcagttg
gatgtatcgctggtgtttacggcgcatccgaccgagattgtccggcatacgattcgggat
aaacagcgacggatcgcgaagattttgcggcagttggatagtgttgaagatagtttgaaa
gcgatcgggctttcctcatcttgggaaacagagtcgctccgagatcagttaaccgaggag
attcgcctctggtggcgcactgatgaactgcaccaatttaagccgactgtgctcgatgaa
gtggatcatgcactgcattacttcagagaggtaatttttgaggcgattccgcatttgtat
acgcgattagagcaagcggtgcatcagtcgttcccgcgcatggaaatgccgagtcgcaat
ttctgtcagtttggatcttgggtgggcgccgatcgtgatggcaatccttcggtcacgccg
caagtcacctggcaaacagcatgttatcagcgccgcatcgttttagagcgctatgtgcaa
tcggttcagtgtttgaccgatttactgagtttgtcgctgcactggagtgatgtcttgccc
gatttgctggagtctttagagcaagatcagcaacgcatgccggatgtgtacgatcgctta
tcgattcgattccgccaagagccgtatcgattaaagcttgcctacattcagaagcgccta
gaaaatacgctcgatcgcaatcacattctctacagcggagatggcttgcagcaagaaatg
cctgaatttgacgaagcaacgctttatcgatcgggcgaagatttcttagcagagttgcga
ctgattcaaagcaatctagctgcgactggattaagctgtcgggacttagagcatttgatt
tgccaagtcgaaatctttggcttctgtttggcgcatcttgatattcgccaagaaagccct
cgccattcggaaacgatgaacgagattgtcgaatatttgcaagtgctgccgaaagcttat
aacgacatgagcgaagcagagcgctgtgaatggttgaccagagaactccagactcgaaga
cctttgattccgacggagatgccattttcggagcgcacccgcgaaacgatttcgacgttc
cggatggttcgcaagcttcagcaagaatttggtctggaaatttgccggacttacatcatc
agcatgagccatgatgtcagtgatttgctagaagtgctgctgtttgccaaagaagccgga
ctgtatgatcccgtcacagggctaggaacgattcaagtcgtaccgttgtttgaaacggtt
gaggatttacagaaagcgcctggaattatgaaacaggtgtttgctcagccgttctacaag
gcgttgattgcggggggctttgacgcgatcgataaaggaacggctttgcaggaagtgatg
cttggctactctgatagtaataaagactctggatttctcagtagtaactgggagattcat
aaagctcagcaagcgttgcaaagaattgccgatgaacatggtgtggcattgcggatcttc
cacggtcgtggcgggtcggtcggtcgcggcggtggacctgcatatgaggcaattttggcg
cagcctggacatagcgtgaatggtcgcatcaagattaccgaacaaggtgaagtactcgca
tcgaagtattctttgcccgagcttgcgttgtataaccttgagacggtgacgactgcggtg
attcaaggcagtttgttgcagaacaagttcgatgagattgcaccgtggcagcaaattatg
gaagaattggcagcgcgatcgcgcacgcactatcgtcaactgatctatgagcaagccgat
tttattgatttcttccatcaggtgactccgatcgaggagattagccagttgcagattagt
tctcgtccggctcgtcgcggcggaaagaaagatttagcaagtctgcgggcaattccttgg
gtctttagctggactcagagccgatttttactgccgtcctggtatggagtcggaacggcg
ttgaatgcgtttctagatgaagcacccgagaagcatatgcagctattgcggcatttttac
tacaaatggccgttcttcaaaatggccatttctcgggtggagatgaccttatcgaaggtc
gatttgcagattgcaggacactatgttcaagaactgactcaagctgaggatcgcgagcga
tttgcgcctgtgtttgagcagattcgacaagagtatttcttgacgcgtgagcttgttctg
aaaattacgggacacaatcgcttactagatggtgatccggaacttcagcgatcagtacag
ttgcgcaatggaacgatcgtaccgttgggattcttgcaagtgtcattgttgaagcgactg
cggcagcataagactctggcggcttctggagttgtgcgatcgcgctacagcaagggtgaa
ttgcttagaggcgcattgttgacgattaacggtattgctgcaggaatgcggaatacgggt
tga

DBGET integrated database retrieval system