KEGG   Leptolyngbya boryana: LBWT_X2300Help
Entry
LBWT_X2300        CDS       T04848                                 

Definition
(GenBank) Malonyl CoA-acyl carrier protein transacylase
Organism
lbo  Leptolyngbya boryana
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
pLBX:complement(269218..274563)
Genome map
AA seq 1781 aa AA seqDB search
MMNHPSDAFPETFWCESTLVALLRYRAMHQPDRLAFTFLLDGETEAVSFTYKELDRQSRA
IAARLQAMGLGGERALLLYPPGLDYLAAFFGCLYAGVVAVPAYPPHNQRNTPRIAAILSD
AQAAIALTTTAILDRMQSLLAEKMNGDTIQWLTTDNLEYSIAETWQEPLIENNTLAFLQY
TSGSTGTPKGVMLSHSNLLHNAAATYRYMEHSPSSTFVSWLPAYHDMGLIGGILQPLYGG
FPCILMSPASFLQRPYRWLQAISRYQGTTSGAPNFAYDLCVEKITAEQRQTLDLSHWSVA
FNGAEPIRHSSLERFAATFAECGFRREAFYPCYGMAEATLMVSGGVQATAPVIKTVQKAA
LERSQVVEADAGDAEVWTLIGCGKTIPEQHIVIVHPETLDRCQPGEVGEIWVSGSSVGQG
YWNRPEESAQTFQAYLSDTHAGPFLRTGDLGFLHDGELFITGRAKDLIIIRGRNLYPQDL
EFTAERSHPTLRIGSSAAFAIALYDAERLVVVQEVEFRQKPNVQEVTQAIRQAIAEAHEV
QAYAVVLIKAGTIPKTSSGKIQRRACKAAFLAGNLAEIGSSILEMVEVENLETSLTRADL
FAFDSAERETQLTDYVRQQVARVLRIAATQVDVQHPLSRFGLDSLMIFEIKSRIELDFGV
EIAIADLFEGASIAELVAQILNQLTTSNPQSACPIVRVKSATNCYSLSFAQQRLWFLDQL
EAANSAYHIAIAVQLQGELNITVLEKSLTEIIRRHEILRTTFCTIAGQVMQQVTDAQILP
LTVVDLRSWVKSEQEVEAQRITKQAIQQPFDLQQEPLFRATLMQLGQEDHQLLLTMHHII
SDRWSAEVMLQELATLYDSYSQEWVSPLPELPIQYADFAHWQRTWLQGEVLETQLAYWKQ
QLNSAPTVLHLPSDRPRPAAQTFRGATKSLHLSRSLTNSLKALARQEGVTLFMLLLAVFK
TLMYRYSGQDRISVGSPIANRNRNEITGLIGFFVNTLVLHTDLAGNPSFRELLNRVRQVA
LGAYTHQDLPFEQLVEAVQPERNMSYSPLFQVMFTLQNAPQLPEIPDLALKPIKVTSETA
QFDLSVAVETVENGLVADFEYNTDLFDESTIARMQHHFQTLLESIVTNPNARLSDLPLLT
AQEQQQLWQWGNQAVSLNPNPDLCIHQLFEAQAKRTPDAIAVIFEQQQLTYQDLNNQADH
LANFLRSLGVAPEGLVGICATRSLDLIIGLLAILKAGGAYVPLDPNLPKERLALMLEDTQ
VPVLLTQTSLLNILPETTARVVCLDSAWNLSEQQSAEHCAPVASNLAYVIYTSGSTGKPK
GVMIEHRSLVSYIETASVEYGIKPGDRVLQFASLSFDVAAEEIFVSLTQGATLVLRTDAM
LDSVSTFLQQCRELALTVLDLPTAFWHQITVELAQGLELPESLRLVIIGGEPALSERLLA
WQMKVRDRVQLLNAYGPTETTIGATICDLSTVSPANSGRIAPIGYPLHNTQLYVLDQNQQ
PVAIGVPGELYVGGGGIARGYLNQPELTAERFIPNPFDRNSTLLYKTGDRVRYLPNGMLE
FLDRIDDQVKIRGFRIELGEIEATLRQHPDVQEAIVLAWADHSNNKRLTAYIRAATPPTP
IDLRHFLEEKLPQYMIPATFLFLDALPLTPSGKIDRRALPAPETAQIASTSTYVAPKTEV
EQAISEVWQAVLQIEKVGIYDNFFDLGGHSLLVLQVQSKLQIALKRSISVTDLFQYPNIS
ALANYLNQTSSSKVSLQAVRDRAAQQRAAFNRQKQLRQSGK
NT seq 5346 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccacccttcagacgcttttccagaaacattttggtgtgaatcgaccctagta
gcgttgctccgttacagggcgatgcatcaacccgatcgcttagcgtttaccttcctcttg
gatggagaaaccgaagcggtgagtttcacctacaaagaactcgatcgtcagagtcgagcg
atcgcagctcggttacaagcgatgggattgggtggggaacgcgcactattgctctaccca
cctgggctggattatctggcagcattttttggttgtctgtatgcgggagtggttgcggtt
cctgcgtatccaccccacaatcagcgaaacacaccgcgaattgcagcaattttatcggac
gcacaagctgcgatcgcgctgacaacaacagccatcctcgacagaatgcaatcactgttg
gctgagaaaatgaatggggatacaatccagtggctaaccacggacaatttggagtactcc
attgctgaaacttggcaggaaccgctgattgagaacaatactctcgcgtttttgcaatat
acatccggttcgactggcacacccaaaggggtcatgctcagtcacagcaacttactgcac
aatgctgctgcgacctatcgctacatggagcattctcctagcagcacgtttgtctcctgg
ctgcctgcttatcacgatatgggcttaattggtgggattctacaaccgttatatggtggg
tttccttgtattctgatgtcgcctgcttcgtttcttcagcgtccttaccgctggctgcaa
gctatttctcgctatcaaggcactactagtggcgcacccaattttgcctatgacttgtgc
gtggagaagattacggcagagcagcgccagacgcttgatctgagtcattggagcgttgca
tttaacggagcagaaccaattcggcacagcagtctagaacggtttgcggctacttttgct
gagtgtgggttccgtcgagaagcgttctacccatgttatgggatggcagaggcaaccctg
atggtttctggtggagtccaagctactgcacccgtgattaagacagtccagaaagcagca
ctggaacgtagtcaagttgtagaggctgatgcaggagatgcagaagtttggacgttgatt
ggatgtgggaaaacaattccagagcaacatattgtcattgttcatcctgaaaccctcgat
cgctgccaacccggtgaagtgggagaaatttgggtatcgggttccagcgtgggacagggc
tactggaatcgtccagaggaaagcgcccaaacctttcaggcgtatctttcagacacccat
gcaggaccattcttacgaactggcgacttaggctttttgcacgatggggaactgttcatc
actggacgcgctaaggatttgatcattattcgagggcgcaatctctatccgcaagacctt
gaattcacggcagaacggagccatcccaccttgagaattggtagcagtgctgcctttgcg
atcgcactctacgatgcagaacggcttgttgtggtacaagaggtcgagtttcgtcaaaag
ccgaatgttcaggaggtaacacaggcaatccgacaagcgatcgcagaagcccacgaggta
caagcctatgctgttgtcttgattaaagcaggcacgattccgaaaacttctagcggtaaa
attcagcgtcgggcttgtaaagcagcgtttctggcaggcaatctagcagagatcggcagc
agtattttagagatggttgaggttgaaaatcttgagacatctctaactcgtgcagatctc
ttcgcatttgattctgcggaacgcgaaacacaactgactgattatgttcggcaacaagtt
gcacgagttttgagaattgcagcaacccaagttgatgtgcagcaccctttaagccgcttc
ggacttgattcgttaatgatctttgagatcaaaagccgcatagagcttgattttggagtt
gagatcgcgatcgcggatttatttgaaggtgctagtattgccgaactggtcgcacaaatt
ctaaatcagcttacaacctcaaatcctcagtcagcttgtccaatcgtgagggttaaaagt
gctacaaattgctattccctttcctttgcccaacagcgattgtggttccttgatcagtta
gaagctgccaattctgcttatcacattgcgatcgcagtgcaacttcaaggtgagttaaat
atcaccgtactggagaaaagcctcaccgaaataattcgacggcacgagattttacgaaca
accttttgcacgatcgcagggcaagtaatgcagcaagtcacagacgcgcagattttgcca
ttgaccgttgtggatttgcgatcgtgggtcaaatcagagcaagaggttgaagcgcaacgc
atcaccaaacaggcaatccagcaaccctttgacttgcagcaagaaccgctcttccgtgcc
accttaatgcaacttgggcaggaagatcatcagttgctattaactatgcatcacatcatc
tccgatcgatggtcggcggaggtcatgctacaggagttagcaacactttatgatagctac
tcccaggaatgggtttcacccttgccggaattgcccattcaatacgccgattttgctcac
tggcagcgaacctggcttcagggtgaagtgctagaaacgcagcttgcctattggaaacag
caactcaacagtgcgccaacggttttacatcttccgagcgatcgtccacgtcctgctgct
caaacctttcgaggggcaacaaaatcgttgcatctttctcgatcgctcaccaattcgctc
aaggcactggcgcggcaagaaggggtgacgctgttcatgctgctgctggcagtcttcaaa
accttaatgtatcgctatagcgggcaagatcggatttctgttggctctcctattgcgaat
cgaaaccgcaatgaaatcacagggctaattggattcttcgtgaacaccttagtgctgcat
actgaccttgcaggaaatcctagctttcgagaattgttgaatcgggttcgtcaggttgcc
ttaggagcctacacccatcaggatttaccgtttgagcaactcgtagaagcagtccaacca
gaacgaaacatgagctattcgcctctgtttcaggtgatgttcacgctccaaaatgctcca
cagcttccagaaataccggatctggctctgaaacctatcaaagtaaccagtgaaacggca
cagtttgatttaagcgtggcagttgaaacagtcgaaaacgggttagttgcagactttgag
tacaatactgatttatttgatgaaagtacgatcgctcggatgcagcatcactttcaaacc
ctactagaaagcattgtcacgaatccgaatgctcggctctcagacttaccgctcctgacc
gcgcaagagcaacaacaactttggcaatggggaaatcaagcggtttctctgaatcccaat
ccagatctatgtattcaccaattatttgaagcgcaggcaaagcgaactcctgatgcgatc
gcggtcatctttgagcagcaacaacttacgtatcaagacctgaataatcaggcggatcac
ctcgcaaatttcctccgctctttgggtgttgctccagagggactcgttggaatctgtgcg
acgcgatcgctagatctcatcattggattgctcgccattctcaaagcgggaggagcctat
gttccgcttgatccaaacctcccgaaagagcgtctcgctctgatgctggaagatactcaa
gtgccagtcctgctgactcaaacatccctgctcaatatcctgccggaaacgacggctaga
gtggtctgcctcgattcagcatggaatctgagcgagcaacaatctgccgaacattgtgct
ccggtcgcctctaatctggcttatgtcatctatacgtctgggtctacgggcaagcctaaa
ggggtaatgatcgaacatcgttccctcgtgagttatatcgagacggcaagcgttgaatat
ggcatcaaaccgggcgatcgcgttttgcaatttgcttctctgagttttgatgtcgcagcc
gaagagatttttgtatccttgacgcaaggagcaacattggtgctgcggactgatgcgatg
ttggattcggtatctaccttcttgcaacagtgccgcgaactggcgttaactgtactcgat
ctaccgactgcattctggcatcaaatcacggttgaactggctcaagggttggaattacct
gagtctttgcgtttagtgattattgggggcgaacctgcactgtctgagcggcttctggct
tggcaaatgaaggttcgcgatcgcgttcaattgttgaatgcttacggtcctacggaaacc
acgatcggcgctacaatctgcgatctatcaacagtatcccctgcaaattcaggacgaatt
gccccgattggatatcctttgcacaatacgcagctctatgtcttggatcagaatcaacag
cccgtggcgatcggggttcctggtgagctatatgttggcggaggtggtattgctcgtggc
tatctaaatcaacctgagctaacggctgaacggtttattcccaatcctttcgatcgcaac
tcaacccttctctataaaacgggcgatcgcgtccgctacctgccaaatggcatgttggaa
ttcctcgatcgcattgatgatcaagtcaaaattcggggctttcggattgagttaggagaa
attgaagcaacactccggcaacatccagacgttcaagaagcgatcgttttagcgtgggca
gatcattcaaataacaaacgtctcactgcctacattcgtgctgctacgccccctacacct
attgatctgcgtcattttctagaggaaaaactgcctcagtacatgatcccagcaaccttt
ctcttcctggatgcattacccctcacacctagcggcaaaattgaccgccgtgccttacct
gctccagagacggctcaaattgcgtcaacgagcacttatgttgctcccaaaaccgaagta
gagcaagcgatctctgaagtttggcaagcggtattgcagattgaaaaagtcggcatttac
gacaacttctttgatctgggcgggcactccttactggtacttcaggtacaaagcaagcta
caaatagcgttgaagcgatcgatatcagtcacggatctatttcagtacccaaacatcagt
gctttagccaattacttgaatcagacatcatcctctaaagtttcgttgcaggcagttcgc
gatcgagccgcacaacaaagagccgcattcaatcgacaaaagcaacttcgtcagtcaggg
aaatag

DBGET integrated database retrieval system