KEGG   Liberibacter crescens: B488_03160Help
Entry
B488_03160        CDS       T02395                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
lcc  Liberibacter crescens
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B488_03160
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B488_03160
Enzymes [BR:lcc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B488_03160
Peptidoglycan biosynthesis and degradation proteins [BR:lcc01011]
 Precursor biosynthesis
  Racemase
   B488_03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(363444..364592)
Genome map
AA seq 382 aa AA seqDB search
MIDSISYTNQLLRFKEADLRLKVDLVALADNWRSLIQKSGTARTSAVIKANAYGLGVESI
ARTLYKIGAKDFFVATVDEGKKLRPYVPQAQIFVLNGIWPGEETSLFNSKLIPVISSQEQ
LDFYMSMLTHYGPYCCALQIDTGLNRLGLSLKEATALSQKLSDEKKSTLLLIMSHLACGN
DPSSPMNIAQLEAFRTVISAYPGIEASLSASGGIFLGKEYHFQLTRPGIAIYGGNSIKNH
YNMKPVVTAEARILMIREAKIGETVSYGGKKKLTRDSRIAIASIGYADGYPLSLSSADIH
PNTKILGGNGFINGHMLPILGQVTMDMTMFDVTNIPEIKIGDYIQVFGSDLKIDEVAHTA
GTTSYEMLLRLGNRYKRLYSLE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgatagattcaatctcttacacaaatcaacttttaagattcaaagaagcagacctgcga
ttaaaagttgatcttgtagctcttgctgataactggagaagtctgatacagaagtcaggt
accgctcgaacatctgcagttatcaaagcgaatgcttatggcttaggtgtggaatcaata
gcccgcactttatataaaattggggcaaaagatttttttgtagctactgtagatgaaggg
aaaaaattacgcccttacgtaccacaagcacaaatctttgtcttgaatggcatatggcca
ggtgaagaaacttccttattcaactcaaagcttattccggttatttcttcgcaagaacag
cttgatttttatatgtcaatgcttactcattacggtccctactgttgtgctttacaaatt
gatactggtcttaataggctgggtcttagcttaaaagaagccacggctctttctcaaaaa
ttatctgatgaaaaaaaatcaaccttgttactaattatgagccatcttgcttgcgggaat
gatccaagctcaccgatgaatattgcccaattagaggcatttcgtaccgttatctctgcc
tatccagggatagaagcaagtttatctgcttcaggggggatcttccttgggaaagaatac
cattttcaattaacccgtcccggaattgctatttatggaggaaattccataaaaaaccac
tataatatgaaacctgttgtcacagcagaagcgcgaattttgatgattcgagaagcaaaa
attggggagactgtaagctatggcgggaaaaaaaaattaactcgtgatagtcgtatagca
attgcttctattggctatgcagatggttatcctctttctctttcaagtgctgatatccat
ccaaatacaaaaattttaggaggaaatggttttataaatggacatatgctgcctattcta
ggacaggtaacaatggacatgacaatgtttgatgtaaccaatattcctgaaataaaaata
ggtgactatattcaagtctttggttctgacttaaaaatagatgaagtagctcatacagct
ggaacaacaagttatgaaatgcttctcaggcttggaaaccgttataagaggctctattca
ttagaataa

DBGET integrated database retrieval system