KEGG   Lates calcarifer (barramundi perch): 108876951Help
Entry
108876951         CDS       T04895                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108876951
   00051 Fructose and mannose metabolism
    108876951
   00052 Galactose metabolism
    108876951
   00500 Starch and sucrose metabolism
    108876951
   00520 Amino sugar and nucleotide sugar metabolism
    108876951
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108876951
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108876951
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108876951
Membrane trafficking [BR:lcf04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108876951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLLDIMHRFRRELAKGLGRDTNPTAA
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVRVSHEKKQTVQMESQIYDTPEDIIH
GSGTRLFDHVAECLGDFMEKHSIKDKKLPVGFTFSFPCQQTKLDEGYLITWTKRFKASGV
EGMDVVKLLNKAIKKRGDYNADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAREGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLSKAKEILTRLG
VEPSADDCIAVQHVCTIVSFRSANLIAATLAGILTRLKENKGVSRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLADQSRQIAETLSEFRLT
TEQLLEVKKRMKTEIQNGLSKSTQDCATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPLEVMQGTGEELFDHIVQCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGILVTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEIGLIAGTGSNACYMEEMRNIEMIEGDEGRMCVNMEWGAFGDNGCLDD
IRTEYDRAVDDFSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGTVSHRAAQLCGAGMAA
VVDKIRENRGLDHLNITVGVDGTLYKLHPHFSRIMHQTVNELAPQCNVNFLLSEDGSGKG
AALITAVGCRLRQELNSK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagcccaactactagcctattacttcactgaactcaaggatgaccaggttaaa
aagatcgataagtacctgtactccatgcgtttctctgatgagacgttactggacatcatg
catcgctttcggagggagctggccaaaggactgggtcgggacactaaccccaccgccgca
ctaaagatgctgccaacgtttgtgcggtcaatccctgatggctcagagaaaggagacttc
attgcattggatctgggaggcagtaacttcaggatcctgcgtgtcagagtcagccatgag
aagaaacagactgttcagatggagagtcagatctatgacacaccagaggacataattcac
ggcagtggaacaagactgttcgaccatgtggcagaatgtcttggtgacttcatggaaaaa
cacagcatcaaagacaagaagctgccagtgggttttaccttctccttcccctgccagcag
actaaactggacgagggatatttgataacatggacaaagcgtttcaaggctagtggagtg
gaggggatggatgttgtcaagctgctcaacaaagctattaagaaacgaggagactataat
gctgacatcatggctgtagtaaatgatacggttggaacgatgatgacctgtgggtttgac
gaccaacgctgtgaagtcggcatcatcattggtacaggcaccaatgcgtgctacatggag
gagctgcgtcacattgacctggtggagggagatgagggccgaatgtgtgtaaacactgag
tggggagccttcggggacgatggcaggctggaagacatcaggacagagttcgacagagag
atagaccgaggctctctcaaccctggcaaacagctatttgagaagatggtcagtggtatg
tacatgggggagttggttcgtctcattcttgtgaaaatggccagagaaggcctgctgttt
gagggaaggatcacccccgagctgcttactaaagggaagtttgagactaagcacgtctca
gccatagagaagagtaaggaaggattgtccaaagccaaagagattctgaccagacttggc
gtggagccttcagctgatgactgtatcgctgtgcagcatgtttgcaccattgtgtctttc
cgctctgccaacctgatagctgccacgctggctggcatcctgacaaggctaaaagagaac
aaaggtgtgtcacgacttcggaccactgtaggcatcgatggatctctctacaagatgcat
ccacagtatgcccgtcgtcttcataagacagtccgtcgtctggtcccggactctgatgtc
cgattcctcctatcagagagtggcagtggaaagggtgctgccatggtgacagctgtggcc
tacagactcgccgaccaatcacgacaaatcgccgaaacattgtccgaattccgcctgaca
accgaacagctgctggaggtaaagaagcgaatgaagacagagatccaaaatggcctttca
aagagcactcaggactgtgctactgtcaaaatgctaccaacctttgtacgaagcactccg
gatggcacagaaaatggtgatttcctggctttggatttaggtggaaccaacttcagagtt
ctgttggtcaagattcgctctggcaagaggagaacagtggagatgcacaacaagatctac
gctattcctctagaagtcatgcagggcacaggagaggagctgtttgatcacattgtgcag
tgcatcagtgacttcctggactacatggggatgaagaacgctcgtcttcctctgggcttc
accttctcgttcccctgccggcagaccagcctggacgctggcatcctggtgacatggacc
aaaggcttcaaggcgacagactgtgaaggagaagatgtggtgggactgttgagggaggca
attaagaggagagaggagtttgacctggatgtagtggctgtagtcaacgatacagtggga
accatgatgacttgtgcctatgaggaacccacctgtgagatcggactcattgctggcact
ggcagtaatgcgtgctacatggaggagatgaggaacatcgagatgattgagggagatgag
ggacggatgtgtgtcaacatggaatggggggctttcggagacaacggatgccttgatgat
attaggacggaatatgaccgcgctgtggatgacttctcactcaatccaggcaaacaaaga
tatgagaaaatgtgcagcggcatgtaccttggtgaaattgtgcgaaacatcctcatagac
atgacaaagagaggattcctgtttagaggacagatttctgagacactgaagaccagaggc
atctttgaaacaaagttcctctcacagatagagagtgacagattggctttgctgcaagtc
agatccatcctacaacacttaggactggacagcacctgtgatgacagtatcattgtcaaa
gaggtatgtggaacagtgtcacatcgtgcagctcagctgtgtggggcaggaatggcggcc
gtggtcgataagatcagagagaaccgaggactggaccatctcaacatcactgtaggggtt
gatggaacgctctacaaacttcatccacatttctcccggatcatgcaccagacagttaat
gaactggctcctcagtgtaatgtcaacttcttgctgtcagaggacggcagtgggaaagga
gctgcactcatcacagccgtgggctgccgactgagacaagagctgaacagtaaatag

DBGET integrated database retrieval system