KEGG   Lates calcarifer (barramundi perch): 108881204Help
Entry
108881204         CDS       T04895                                 

Gene name
gck
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  
glucokinase [EC:2.7.1.2]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    108881204 (gck)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108881204 (gck)
   00052 Galactose metabolism
    108881204 (gck)
   00500 Starch and sucrose metabolism
    108881204 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    108881204 (gck)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108881204 (gck)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108881204 (gck)
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     108881204 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 478 aa AA seqDB search
MPCVSSHLDQMVKMPCNYGSVLDKILMVEQILSEFRLNKEDLKEIMERMQHEMDRGLRIE
THEEASVKMLPTYVCSTPEGSEVGDFLALDLGGTNFRVMLVIVGEDEERSWKVETKNQMY
SIPEDAMTGTAEMLFDYIAECMSDFLDKHHIKHKKLPLGFTFSFPVRHEDIDKGILINWT
KGFKASGAEGNNIVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGT
GCNACYMEEMRTVELVEGEEGRMCVNTEWGAFGDNGELEEFRLEYDRVVDETSINPGHQL
YEKVISGKYMGELVRLVLMKLVNEDLLFNGEASEQLKTRGSFETRFVSQVESDTGDRKQI
YNILSSLGVLPSELDCDIVRLVCESVSTRSAHMCGAGLAGVINRMRERRCQEALKITVGV
DGSVYKLHPCFRDKFHKIVRDLTPHCEITFIQSEEGSGRGAALISAVACKMAACMLTQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtgtcagctctcatcttgaccagatggtgaagatgccttgtaactacggctct
gtgcttgataaaatcctcatggtagagcagatcctgtcagagttcagactgaataaggag
gacctaaaagaaattatggagaggatgcagcatgaaatggacagaggactgcgtatagag
acacacgaggaggccagtgtcaaaatgcttccgacttatgtctgctccacccctgaggga
tcagaggtgggcgatttcctggctctggacctgggtggtacaaacttccgtgtcatgctg
gtcatagtgggtgaagatgaggaaaggagctggaaggtggagaccaagaaccaaatgtac
tccattcctgaagatgccatgacagggactgctgaaatgctgtttgactacatagcagag
tgtatgtcagactttctggacaaacaccatatcaagcacaagaagcttcctctgggtttt
accttctcctttccagtacgacatgaggacattgacaagggtatcctgattaactggact
aaaggcttcaaggcttctggggcagaagggaacaatattgtgggtttactcagagatgcc
atcaagagacgaggggactttgagatggatgtggttgccatggtgaatgacacagtagca
accatgatttcctgttattacgaggatcgcagctgtgaagttgggatgattgttggtact
ggttgtaatgcatgttacatggaggagatgaggactgtggagttggtagaaggggaggag
ggccggatgtgtgtgaacactgagtggggggcgtttggagacaacggggagctggaggag
ttcaggctggagtacgacagagtggtggatgagacctcaattaaccctggacaccagcta
tatgagaaggtgatcagtgggaagtatatgggtgagttggtcaggcttgttctgatgaag
ctggtgaatgaagacctgctgttcaatggtgaggcctcagagcagctgaagacacgtggc
agctttgagacgcggttcgtctcacaagtggagagtgacactggtgacagaaaacaaatc
tacaatatcttgtcctcactgggtgttctgccatcagagctggactgtgacattgtgcgt
ctggtctgtgagagcgtttcaactcgctctgctcacatgtgtggtgcggggctcgctggt
gtgatcaaccgaatgcgggagcgacgctgccaggaagcccttaagatcacagtgggggtt
gacggatcggtctacaagctgcacccatgtttccgtgacaagttccacaaaatcgtcagg
gacctcacgcctcactgtgagatcaccttcatccagtcagaggaggggagtggtcgtgga
gcagcccttatctcagcagtggcctgtaaaatggctgcctgcatgctgacacaataa

DBGET integrated database retrieval system