KEGG   Lates calcarifer (barramundi perch): 108881294Help
Entry
108881294         CDS       T04895                                 

Gene name
aldh7a1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00010  Glycolysis / Gluconeogenesis
lcf00053  Ascorbate and aldarate metabolism
lcf00071  Fatty acid degradation
lcf00260  Glycine, serine and threonine metabolism
lcf00280  Valine, leucine and isoleucine degradation
lcf00310  Lysine degradation
lcf00330  Arginine and proline metabolism
lcf00340  Histidine metabolism
lcf00380  Tryptophan metabolism
lcf00410  beta-Alanine metabolism
lcf00561  Glycerolipid metabolism
lcf00620  Pyruvate metabolism
lcf01100  Metabolic pathways
Module
lcf_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
lcf_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lcf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108881294 (aldh7a1)
   00053 Ascorbate and aldarate metabolism
    108881294 (aldh7a1)
   00620 Pyruvate metabolism
    108881294 (aldh7a1)
  Lipid metabolism
   00071 Fatty acid degradation
    108881294 (aldh7a1)
   00561 Glycerolipid metabolism
    108881294 (aldh7a1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    108881294 (aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    108881294 (aldh7a1)
   00310 Lysine degradation
    108881294 (aldh7a1)
   00330 Arginine and proline metabolism
    108881294 (aldh7a1)
   00340 Histidine metabolism
    108881294 (aldh7a1)
   00380 Tryptophan metabolism
    108881294 (aldh7a1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108881294 (aldh7a1)
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108881294 (aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     108881294 (aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     108881294 (aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108881294
NCBI-ProteinID: XP_018528726
LinkDB All DBs
Position
Unknown
AA seq 542 aa AA seqDB search
MQRCLTLTLARNSRLLLRNKLASVRCQQSAAMSGLLINQPKYSWLKELGLSEDNPGVYNG
TWGGSGEVVTSYCPANNEPIARVTQATLAEYEETVQKTKEAWKIWADIPAPKRGEIVRQI
GDALRKKIKVLGSLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGPILPSERPGHA
LIEQWNPVGLVGIITAFNFPVAVYGWNNAIALTCGNVCLWKGAPTTPLTSVAVTKIVAEV
LEQNNLPGAICSMTCGGADIGTAMAKDERVDLVSFTGSTHVGKMVAMMVQERFGRKLLEL
GGNNAIIVFEDADLNLVVPSAVFASVGTAGQRCTTTRRLMLHESVHDTVVERIAKAYKQV
RIGDPWDPSTLYGPLHTKQAVDQYLAAIEQAKQQGGTLVCGGKVMDRPGNYVEPTIITGL
AHDAPIVHTETFVPILYVLKFKTEEEAFAWNNEVQQGLSSSIFTKDMGRVFRWLGPKGSD
CGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQGIK
FE
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgctgcctgactctgacccttgcccggaacagcaggctcctcttgagaaataaa
ttagcatctgtccgctgccagcagtcagcagccatgtcaggactcctcatcaaccagccc
aaatactcctggctgaaagagctcggcctgtccgaggacaaccccggtgtttacaacggg
acctggggaggcagcggggaggtcgtcacgtcttattgccctgccaacaatgagccaatc
gccagagttacacaggctactttggcggagtatgaagaaactgtccagaagaccaaggag
gcttggaagatatgggcagatattccggctccgaaaagaggggagattgtgaggcagatt
ggagatgcgctgagaaaaaagatcaaagtccttgggagcttagtgtctctagaaatgggc
aagatctatgttgagggagtgggcgaggttcaggaatacgttgatgtctgtgattacgct
gtcggtctgtctagaatgattggcggacccatcttgccttcagaaagaccaggccatgct
ctgatcgaacagtggaacccagttggtcttgtcggcatcatcactgcctttaacttcccg
gtggctgtctacggctggaacaatgccatcgctctgacctgcggcaacgtctgcctgtgg
aaaggagctccgaccacacctctcacaagtgtcgccgttaccaagatcgtggctgaggtg
ctggagcaaaacaatctgcccggggcgatctgctccatgacctgcggaggtgccgatatc
ggtaccgccatggccaaggacgagcgtgtggatctggtgtcgttcaccggcagcacccac
gttggcaagatggtggccatgatggtgcaggaaaggttcggtcgcaagctgctggagctt
ggcggaaacaacgccattatcgtgtttgaggatgctgacctaaatctcgtggtgccctct
gctgtctttgcatctgtgggaaccgccggccaacgctgcaccacaaccaggaggctgatg
ctgcatgagagcgttcacgacacagtggtcgagaggatcgccaaggcctacaaacaagtc
cgcatcggagacccctgggatcccagcaccctttatgggcctctgcacaccaagcaagct
gtggatcagtacctggcagctattgagcaggccaagcaacagggcggcactctggtctgt
ggagggaaggtgatggaccgtcccggaaactatgtggagcccaccatcatcacagggctg
gctcacgacgctcccatcgtccacacagaaacctttgtccccatcctctatgtcctcaag
ttcaagacagaagaggaggcatttgcctggaacaacgaggtccaacagggtctgtccagc
agcatcttcaccaaggatatgggccgggtcttccgctggctgggacccaaaggatccgac
tgcggcatcgtgaatgtcaacattcctacaagcggagctgaaatcggaggagccttcggc
ggagagaaacacactggaggcggaagagagtccggcagtgactcatggaagcagtacatg
aggcgttcaacgtgcacgataaactacagcaaggatcttcctctggcccagggaatcaag
ttcgagtga

DBGET integrated database retrieval system