KEGG   Lates calcarifer (barramundi perch): 108883954Help
Entry
108883954         CDS       T04895                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
Enzymes [BR:lcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108883954
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 782 aa AA seqDB search
MPGERLTVRGTSEIGRYPGAAPPTRVELSIQKEGEKKQEEGGCRRWFRKMCPCCCKRQNS
TSYDITDKVELVKPPTPGPEPVKPKAENGEAKEMEEIKLSVRSVDLLSSKTGQNRQEHHT
DLYHDDELIIRRGQTFQMELELNRPFNADTDKLHLDLRTGPLPMVSKGTHVIIPLVDHLE
DERWEAKIVEQNGNKIKLSVNSPANAVIGLYGLSVTTGSLKGESTTTHNSSKNIVMLFNP
WCEEDTVFLDDEEERKEYVLNDTGRIYYGTEKQIGARTWNFGQFHEGILDACLFILEKSD
MPPSGRGDPVNVVRVISAMINAQDDFGVLVGNWSGNYSDGVSPAAWSSSVEILRKYHSTD
GTPVSYGQCWVFSGVTTTVLRCLGIPARSVTNFQSAHDTDVSLTTDVYFDENMEPLDYLN
NDSVWNFHVWNDCWMARPDLPPGNGGWQAVDSTPQETSQGTFRCGPASVNAIRSGQVYLK
HDTPFVFAEVNSDKIYWQRNLDGTFSQIHSEKKAVGHYISTKAVGSDERADITHLYKHQE
GSEEERIAVETASRYGSKPDAYSTPVAEDVTVEVKMDGEGPRMGADAKLSILVKNLSSQP
RQATLHSQVAVMYYTGVLKGTIKKEQMSVELSPNEEKTIEWILPYQQYQDQLVDQAALML
TLSGRVSETQQVLANQTTFRLRTPDLNITPLGEAVVGKEMAAKITFTNPLPRTLKGVVFR
VEGLGLQKGHEVVVGDVSGHSTVTLTEHFIPTQPGPRKLVASLDCKQLTQVHGVANVVVL
EK
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcgagcggttgacagtaagaggcacgtcggagattgggcgttaccccggagca
gccccacccaccagggtcgagctgagcattcagaaagagggggagaagaaacaggaagag
ggaggctgtcgccggtggttcaggaagatgtgcccgtgctgctgtaagcgccagaacagc
acctcctatgatatcacagacaaggttgaactggtcaaaccccctaccccgggtccagag
cctgtcaaaccaaaagctgagaatggagaggcaaaggaaatggaagaaataaagttgtcg
gtgcgttcggtggacctgctgagctccaagaccggtcagaacagacaggagcatcacact
gacctgtatcacgacgatgagctgatcatccgcagaggacagaccttccagatggagcta
gagctgaacaggccattcaatgctgacactgacaagctgcatctggacctgcgaacaggt
cccctgcccatggtgtccaaaggcacccacgtcatcattccactggtggatcacctggag
gatgaacgctgggaggcaaaaatcgtagagcaaaatggcaacaagatcaagctgtctgtc
aactcgccggccaatgctgtgatcggtctgtacgggctcagtgtgacgactggctctctc
aagggtgaaagcacaactacccacaactccagcaagaacatcgtcatgctcttcaacccc
tggtgtgaagaggacacagtgttcctggatgatgaggaggagaggaaggagtatgtgctg
aatgacactgggaggatttactatggcacagagaaacaaatcggtgcccgtacatggaac
tttgggcagtttcatgaaggaatcctggatgcatgtctgttcatcctggagaagagtgat
atgcctccatctggtcgaggggatcctgtcaacgtggtcagggtcatatctgccatgata
aacgctcaggatgactttggggttctggttgggaactggtctgggaattactctgatggg
gtctctcctgctgcatggagcagcagcgtggagatcctgaggaaataccactccactgat
ggcacgcctgtgtcatatggacagtgctgggtcttttctggggtcactacaacagtgctg
cgctgtcttggaataccggcccgcagtgtgaccaacttccagtctgctcatgatactgat
gtgtctctcactacagatgtgtattttgatgagaatatggagccgctcgactacctcaat
aatgactctgtatggaatttccatgtatggaatgactgctggatggctagaccagacctg
cctcctggtaatggaggctggcaggctgttgactccactccccaggagacaagccagggc
accttccgctgtggccctgcctctgtcaacgccatccgctctggccaggtctacctcaaa
cacgacacgccttttgtctttgctgaggtcaacagtgataagatctactggcagaggaac
ctggatggtactttcagccagatccacagtgagaagaaagctgtcggccactacatcagc
accaaagctgtgggctctgacgagcgggcagacatcacacatctgtacaaacaccaagaa
ggttcagaagaggaacgcatcgctgtggagacagctagtcgctatggcagcaagccagac
gcctactctacgcctgtggcagaggacgtgactgtggaggtgaagatggacggtgagggg
cccaggatgggtgccgatgctaagctcagcatcctggtgaaaaacctgagctcacagcct
cgccaggcaacactgcacagccaggtggccgtcatgtactacactggtgtgctgaagggc
accatcaagaaggagcagatgtctgtggagctttcacccaatgaagaaaagaccattgag
tggattctgccctaccagcaatatcaagatcagctggtggatcaggcagccctgatgctg
accttgtctggaagagtcagtgagacccagcaagtgttagccaaccagaccactttcagg
ctccgtacgcctgacctcaacatcacgcctttgggagaagctgtggttggtaaggagatg
gcagcaaagatcaccttcaccaaccccctgccacgtacactaaagggtgtggtgttcaga
gtggagggcctgggtctacaaaagggccatgaagtggttgtaggtgacgtcagtggtcac
tccacggtgactttgacggagcacttcatccccacccagcccggacccaggaagctggtg
gcgtctctcgactgcaaacagctcacacaagtgcatggagtggccaatgttgttgttctt
gaaaaatga

DBGET integrated database retrieval system