KEGG   Lates calcarifer (barramundi perch): 108884454Help
Entry
108884454         CDS       T04895                                 

Definition
(RefSeq) uncharacterized protein LOC108884454
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108884454
Peptidases [BR:lcf01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108884454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 2589 aa AA seqDB search
MSAAHCFSSTSTSGWQISLGRQNLQGNNPNEVSRTVARIILHPNYDSITNNNDIALLKLS
SPVTFTDYIRPVCLAAGGSVFNNGTDSWVTGWGAVKEGVSLPFPETLQEVEVPVLGNRQC
NCLNGVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPNLP
GVYSRVSRYQSWINSFISSDKPGFVQFTSSGPDADSSYTCPGLPPPVITTTTGSSTTTPA
TTTDSPSTESSAKLCGITPLNPRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLVNREWVI
SAAHCFFSTSTSGWQISLGRQNLQGNNPNEVSRTVARIILHPNYDSITNNNDIALLKLSS
PVTFTDYIRPVCLAAGGSVFNNGTDSWVTGWGAVKEGVSLPFPETLQEVEVPVLGNRQCN
CLNGVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPNLPG
VYSRVSRYQSWINSFISSDKPGFVQFTSSGPDADSSYTCPGLPPPVITTTTGSSTTTPAT
TTDSPSTESSAKLCGITPLNPRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLVNREWVIS
AAHCFSSTSTSGWQISLGRQNLQGNNPNEVSRTVARIILHPNYDSITNNNDIALLKLSSP
VTFTDYIRPVCLAAGGSVFNNGTDSWVTGWGAVKEGVSLPFPETLQEVEVPVLGNRQCNC
LNGVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPNLPGV
YSRVSRYQSWINSFISSDKPGFVQFTSGGPDADSSYTCPGLPPPVITTTTGSSTTTPATT
TDSPSTESSAKLCGITPLNPRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLVNREWVISA
AHCFSSTSTSGWQISLGRQNLQGNNPNEVSRTVARIILHPNYDSITNNNDIALLKLSSPV
TFTDYIRPVCLAAGGSVFNNGTDSWVTGWGAVKEGVSLPFPETLQEVEVPVLGNRQCNCL
NGVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPNLPGVY
SRVSRYQSWINSFISSDKPGFVQFTSSGPDADSSYTCPGLPPPVITTTTGSSTTPPATTT
DSPSTESSAKLCGITPLNPRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLVNREWVISAA
HCFSSTSTSGWQISLGRQNLQGNNPNEVSRTVARIILHPNYDSITNNNDIALLKLSSPVT
FTDYIRPVCLAAGGSVFNNGTDSWVTGWGAVKEGVSLPFPETLQEVEVPVLGNRQCNCLN
GVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPNLPGVYS
RVSRYQSWINSFISSDKPGFVQFTSSGPDADSSYTCPGLPPPVITTTTGSSTTTPATTTD
SPSTESSAKLCGITPLNPRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLVNREWVISAAH
CFSSTSTSGWQISLGRQNLQGNNPNEVSRTVARIILHPNYDSITNNNDIALLKLSSPVTF
TDYIRPVCLAAGGSVFNNGTDSWVTGWGAVKEGVSLPFPETLQEVEVPVLGNRQCNCLNG
VGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPNLPGVYSR
LSRYQSWINSFISSDKPGFVQFTSSGPDADSSYTCPGLPPPVITTTTGSSTTPPATTTDS
PSTESSAKLCGITPLNPRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLVNREWVISAAHC
FFSTSTSGWQISLGRQNLQGNNPNEVSRTVARIILHPNYDSITNNNDIALLKLSSPVTFT
DYIRPVCLAAGGSVFNNGTDSWVTGWGAVKEGVSLPFPETLQEVEVPVLGNRQCNCLNGV
GTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPNLPGVYSRV
SRYQSWINSFISSDKPGFVQFTSSGPDADSSYTCPGLPPPVITTTTGSSTTTPATTTDSP
STESSAKLCGITPLNPRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLVNREWVISAAHCF
SSTSTSGWQISLGRQNLQGNNPNEVSRTVARIILHPNYDSITNNNDIALLKLSSPVTFTD
YIRPVCLAAGGSVFNNGTDSWVTGWGAVKEGVSLPFPETLQEVEVPVLGNRQCNCLNGVG
TVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPNLPGVYSRVS
RYQSWINSFISSDKPGFVQFTSSGPDADSSYTCPGLTPPSTASPTTRPSTTTPTLTSPAR
SVCGKAPMNSRAVGDSGVVPGEMWPWVVSLHKNGVYTCGGTLITDNFVLTSGQCFSTSNP
DVHEWSVFLGQQRVNGSEEFEMSLGVVNITVSKMTGSNIALLQLAKPVSYTNYIQPVCLD
ISNDRSFPIGSSCWVAGWGKGSKSRGADKDGSGLRDLETQVANCGNVSDSENICTYTLDL
QQVKMFSHPPMFLKIFLCFHQGRTFQNGIVRTSLTINPLFEFTGGSRQSLAVQVRLVLVP
GGRRNNEWK
NT seq 7770 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctcactgcttctccagtacaagtacatctggatggcaaatttctctcggc
cgtcagaacctgcagggcaacaacccaaacgaagtgtccagaactgtcgccagaatcatt
ttacatcccaactatgacagcatcaccaacaacaatgacattgctctgctcaaactctcc
tcaccagtcacgttcacagactacatcagacctgtgtgtctggcagcaggtggcagtgtg
ttcaacaacggtactgatagctgggtgactggctggggagcagtcaaggagggagtgtcg
ttaccgttccctgaaactctgcaagaagttgaggttccagttctgggaaaccgacagtgt
aactgtctgaatggagtcggtacagtcacagacaacatgatctgtgctggtgttctggca
ggaggcaaagactcatgtcagggtgactcaggaggtccaatggtgagcaaacagggctcc
gtctgggtccagtctggaatagttagttttggttttggctgtgctcgacccaatctgccg
ggagtgtactccagagtgtcacgttaccagtcctggatcaactctttcatcagctctgat
aagccaggctttgtccagttcacctccagtgggcctgatgctgacagcagctacacctgt
cctggtctaccacctcctgtcattactactactactggttctagtactacaacaccagct
acaaccaccgattcaccatccactgaatcaagtgctaaattatgtggcatcactcccctg
aaccccaggatagttggaggtgaagatgctccacctggaagttggccctggcaggttagt
ctgcagaggtttggtggccatgtttgtggtggttccctcgtcaacagagagtgggtgata
tctgctgctcactgcttcttcagtacaagtacatctggatggcaaatttctctcggccgt
cagaacctgcagggcaacaacccaaacgaagtgtccagaactgtcgccagaatcatttta
catcccaactatgacagcatcaccaacaacaatgacattgctctgctcaaactctcctca
ccagtcacgttcacagactacatcagacctgtgtgtctggcagcaggtggcagtgtgttc
aacaacggtactgatagctgggtgactggctggggagcagtcaaggagggagtgtcgtta
ccgttccctgaaactctgcaagaagttgaggttccagttctgggaaaccgacagtgtaac
tgtctgaatggagtcggtacagtcacagacaacatgatctgtgctggtgttctggcagga
ggcaaagactcatgtcagggtgactcaggaggtccaatggtgagcaaacagggctccgtc
tgggtccagtctggaatagttagttttggttttggctgtgctcgacccaatctgccggga
gtgtactccagagtgtcacgttaccagtcctggatcaactctttcatcagctctgataag
ccaggctttgtccagttcacctccagtgggcctgatgctgacagcagctacacctgtcct
ggtctaccacctcctgtcattactactactactggttctagtactacaacaccagctaca
accaccgattcaccatccactgaatcaagtgctaaattatgtggcatcactcccctgaac
cccaggatagttggaggtgaagatgctccacctggaagttggccctggcaggttagtctg
cagaggtttggtggccatgtttgtggtggttccctcgtcaacagagagtgggtgatatct
gctgctcactgcttctccagtacaagtacatctggatggcaaatttctctcggccgtcag
aacctgcagggcaacaacccaaacgaagtgtccagaactgtcgccagaatcattttacat
cccaactatgacagcatcaccaacaacaatgacattgctctgctcaaactctcctcacca
gtcacgttcacagactacatcagacctgtgtgtctggcagcaggtggcagtgtgttcaac
aacggtactgatagctgggtgactggctggggagcagtcaaggagggagtgtcgttaccg
ttccctgaaactctgcaagaagttgaggttccagttctgggaaaccgacagtgtaactgt
ctgaatggagtcggtacagtcacagacaacatgatctgtgctggtgttctggcaggaggc
aaagactcatgtcagggtgactcaggaggtccaatggtgagcaaacagggctccgtctgg
gtccagtctggaatagttagttttggttttggctgtgctcgacccaatctgccgggagtg
tactccagagtgtcacgttaccagtcctggatcaactctttcatcagctctgataagcca
ggctttgtccagttcacctccggtgggcctgatgctgacagcagctacacctgtcctggt
ctaccacctcctgtcattactactactactggttctagtactacaacaccagctacaacc
accgattcaccatccactgaatcaagtgctaaattatgtggcatcactcccctgaacccc
aggatagttggaggtgaagatgctccacctggaagttggccctggcaggttagtctgcag
aggtttggtggccatgtttgtggtggttccctcgtcaacagagagtgggtgatatctgct
gctcactgcttctccagtacaagtacatctggatggcaaatttctctcggccgtcagaac
ctgcagggcaacaacccaaacgaagtgtccagaactgtcgccagaatcattttacatccc
aactatgacagcatcaccaacaacaatgacattgctctgctcaaactgtcctcaccagtc
acgttcacagactacatcagacctgtgtgtctggcagcaggtggcagtgtgttcaacaac
ggtactgatagctgggtgactggctggggagcagtcaaggagggagtgtcgttaccgttc
cctgaaactctgcaagaagttgaggttccagttctgggaaaccgacagtgtaactgtctg
aatggagtcggtacagtcacagacaacatgatctgtgctggtgttctggcaggaggcaaa
gactcatgtcagggtgactcaggaggtccaatggtgagcaaacagggctccgtctgggtc
cagtctggaatagttagttttggttttggctgtgctcgacccaatctgccgggagtgtac
tccagagtgtcacgttaccagtcctggatcaactctttcatcagctctgataagccaggc
tttgtccagttcacctccagtgggcctgatgctgacagcagctacacctgtcctggtcta
ccacctcctgtcattactactactactggttctagtactacaccaccagctacaaccacc
gattcaccatccactgaatcaagtgctaaattatgtggcatcactcccctgaaccccagg
atagttggaggtgaagatgctccacctggaagttggccctggcaggttagtctgcagagg
tttggtggccatgtttgtggtggttccctcgtcaacagagagtgggtgatatctgctgct
cactgcttctccagtacaagtacatctggatggcaaatttctctcggccgtcagaacctg
cagggcaacaacccaaacgaagtgtccagaactgtcgccagaatcattttacatcccaac
tatgacagcatcaccaacaacaatgacattgctctgctcaaactgtcctcaccagtcacg
ttcacagactacatcagacctgtgtgtctggcagcaggtggcagtgtgttcaacaacggt
actgatagctgggtgactggctggggagcagtcaaggagggagtgtcgttaccgttccct
gaaactctgcaagaagttgaggttccagttctgggaaaccgacagtgtaactgtctgaat
ggagtcggtacagtcacagacaacatgatctgtgctggtgttctggcaggaggcaaagac
tcatgtcagggtgactcaggaggtccaatggtgagcaaacagggctccgtctgggtccag
tctggaatagttagttttggttttggctgtgctcgacccaatctgccgggagtgtactcc
agagtgtcacgttaccagtcctggatcaactctttcatcagctctgataagccaggcttt
gtccagttcacctccagtgggcctgatgctgacagcagctacacctgtcctggtctacca
cctcctgtcattactactactactggttctagtactacaacaccagctacaaccaccgat
tcaccatccactgaatcaagtgctaaattatgtggcatcactcccctgaaccccaggata
gttggaggtgaagatgctccacctggaagttggccctggcaggttagtctgcagaggttt
ggtggccatgtttgtggtggttccctcgtcaacagagagtgggtgatatctgctgctcac
tgcttctccagtacaagtacatctggatggcaaatttctctcggccgtcagaacctgcag
ggcaacaacccaaacgaagtgtccagaactgtcgccagaatcattttacatcccaactat
gacagcatcaccaacaacaatgacattgctctgctcaaactctcctcaccagtcacgttc
acagactacatcagacctgtgtgtctggcagcaggtggcagtgtgttcaacaacggtact
gatagctgggtgactggctggggagcagtcaaggagggagtgtcgttaccgttccctgaa
actctgcaagaagttgaggttccagttctgggaaaccgacagtgtaactgtctgaatgga
gtcggtacagtcacagacaacatgatctgtgctggtgttctggcaggaggcaaagactca
tgtcagggtgactcaggaggtccaatggtgagcaaacagggctccgtctgggtccagtct
ggaatagttagttttggttttggctgtgctcgacccaatctgccgggagtgtactccaga
ttgtcacgttaccagtcctggatcaactctttcatcagctctgataagccaggctttgtc
cagttcacctccagtgggcctgatgctgacagcagctacacctgtcctggtctaccacct
cctgtcattactactactactggttctagtactacaccaccagctacaaccaccgattca
ccatccactgaatcaagtgctaaattatgtggcatcactcccctgaaccccaggatagtt
ggaggtgaagatgctccacctggaagttggccctggcaggttagtctgcagaggtttggt
ggccatgtttgtggtggttccctcgtcaacagagagtgggtgatatctgctgctcactgc
ttcttcagtacaagtacatctggatggcaaatttctctcggccgtcagaacctgcagggc
aacaacccaaacgaagtgtccagaactgtcgccagaatcattttacatcccaactatgac
agcatcaccaacaacaatgacattgctctgctcaaactgtcctcaccagtcacgttcaca
gactacatcagacctgtgtgtctggcagcaggtggcagtgtgttcaacaacggtactgat
agctgggtgactggctggggagcagtcaaggagggagtgtcgttaccgttccctgaaact
ctgcaagaagttgaggttccagttctgggaaaccgacagtgtaactgtctgaatggagtc
ggtacagtcacagacaacatgatctgtgctggtgttctggcaggaggcaaagactcatgt
cagggtgactcaggaggtccaatggtgagcaaacagggctccgtctgggtccagtctgga
atagttagttttggttttggctgtgctcgacccaatctgccgggagtgtactccagagtg
tcacgttaccagtcctggatcaactctttcatcagctctgataagccaggctttgtccag
ttcacctccagtgggcctgatgctgacagcagctacacctgtcctggtctaccacctcct
gtcattactactactactggttctagtactacaacaccagctacaaccaccgattcacca
tccactgaatcaagtgctaaattatgtggcatcactcccctgaaccccaggatagttgga
ggtgaagatgctccacctggaagttggccctggcaggttagtctgcagaggtttggtggc
catgtttgtggtggttccctcgtcaacagagagtgggtgatatctgctgctcactgcttc
tccagtacaagtacatctggatggcaaatttctctcggccgtcagaacctgcagggcaac
aacccaaacgaagtgtccagaactgtcgccagaatcattttacatcccaactatgacagc
atcaccaacaacaatgacattgctctgctcaaactctcctcaccagtcacgttcacagac
tacatcagacctgtgtgtctggcagcaggtggcagtgtgttcaacaacggtactgatagc
tgggtgactggctggggagcagtcaaggagggagtgtcgttaccgttccctgaaactctg
caagaagttgaggttccagttctgggaaaccgacagtgtaactgtctgaatggagtcggt
acagtcacagacaacatgatctgtgctggtgttctggcaggaggcaaagactcatgtcag
ggtgactcaggaggtccaatggtgagcaaacagggctccgtctgggtccagtctggaata
gttagttttggttttggctgtgctcggcccaatctgccgggagtgtactccagagtgtca
cgttaccagtcctggatcaactctttcatcagctctgataagccaggctttgtccagttc
acctccagtgggcctgatgctgacagcagctacacctgtcctggtctaacacccccctca
acagcttcaccaacaacaaggccaagtactactaccccaactttaaccagtcctgcaaga
tcagtgtgtggtaaagctcccatgaacagtcgtgctgtaggtgacagcggtgttgtgcct
ggagaaatgtggccctgggtggtgagtctccataaaaatggcgtctacacatgtggagga
accctcatcactgacaactttgtcctcacttctggccagtgcttctctacttccaatcca
gatgtccatgagtggagtgtgtttctgggccagcaacgtgtgaatggctctgaggagttt
gagatgtctctgggtgttgtgaacatcacagtgagcaaaatgacaggctccaatattgct
ctgctacagctggctaaaccagtcagctacaccaattacatccagcctgtgtgtttggac
attagcaacgacaggtccttcccaattggtagttcttgctgggtagcaggctgggggaag
ggaagtaaaagcagaggtgctgataaagatggctcaggccttcgagaccttgaaactcaa
gtggcaaattgtgggaatgtttctgattcagagaacatttgtacctataccctggacctt
caacaggtaaaaatgttttcgcatccaccaatgtttctaaaaatctttttgtgttttcat
caaggcagaacttttcagaatgggattgtcaggacctcactgacgataaatcctcttttt
gaattcacagggggatcaaggcagtcccttgctgtgcaagtcagactcgtcttggttcca
ggtggccgtcgtaacaatgagtggaagtaa

DBGET integrated database retrieval system