KEGG   Lates calcarifer (barramundi perch): 108893710Help
Entry
108893710         CDS       T04895                                 

Gene name
neu3
Definition
(RefSeq) sialidase-3
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lcf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    108893710 (neu3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    108893710 (neu3)
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     108893710 (neu3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 405 aa AA seqDB search
MGNTPSKSGSGEELVKTTLFEKEPSGITYRIPALIYLRHSHTFLAFAEKRSCPSDHDAKI
LVMRRGALQDDGSVQWSSSQELSTACLPNHRTMNPCPVYEKNSKTLFLFFICIWGNTTEC
RQVITGKNKARLCCVSSSDDGQTWSQAKDLTESVIGETVHKWATFAVGPGHGVQLENGRL
IIPAYAYYVPYRCFSFPIPFTVYPRALSIYSEDFGQTWRIGKMLRKKSCECEMAEIIDHE
GRSHLYCNARHTGGHRCEALSENSGVYFDKPHMAPELVEPPSGCQGSVIGFPAPEFVPND
DAESKACGTSLLSPDTQTWLLFMHPTNKSSRRDMGVYLNRSPLHSSGWDRPRIIHNGPSG
YSDLAYNGDKDQFSCLIECGKESELEQIAFMSFTLNDVMQTGSKK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggggaacacaccttcaaaaagtggcagtggagaggagttggtcaaaacaactttgttt
gaaaaggaaccaagtgggataacatacagaattcctgctctcatttatctaaggcatagt
cacaccttccttgcctttgcagagaaaagatcctgcccttctgaccatgatgccaaaatc
cttgttatgagaagaggagcgctgcaagatgatggatctgttcagtggtcctccagtcag
gagctgtcaacagcatgtctaccaaaccaccgcaccatgaatccttgccctgtgtatgag
aaaaacagcaaaacactgtttttatttttcatttgcatctggggaaacaccacagagtgt
aggcaagtcatcacaggtaagaacaaggcacgtctttgctgtgttagcagcagtgatgat
gggcaaacttggagtcaagcgaaagacttaacagaaagcgtgatcggtgaaactgtccat
aagtgggccacattcgctgtggggcccggccacggtgttcagctggagaatggaaggttg
atcatcccagcatacgcctattatgtcccgtacagatgcttttccttccccattcctttt
acagtctacccacgtgcactgtctatttatagcgaggactttggacagacatggcgtata
ggcaagatgcttcgaaaaaagtcatgtgaatgtgagatggcagagatcatagaccacgag
ggcaggagtcatctttactgcaatgctcgtcacactggaggccacagatgtgaggccctg
agtgaaaacagtggcgtgtattttgacaagccccacatggctccagagcttgtcgagcca
ccctcaggctgtcaaggcagtgtcattggctttcctgctccagaatttgtcccaaatgat
gatgccgaaagcaaagcttgcggcacttcacttctgtctccagacacacaaacctggctc
ctcttcatgcacccaaccaataagtctagtagaagggacatgggcgtgtatttgaaccga
tcccctctgcactcgtcgggttgggacaggcccaggatcatccacaacggacccagtggc
tactcagacctggcctacaatggggacaaggatcagttttcgtgcctgatagagtgcggg
aaagagagtgaactcgagcagattgcgttcatgtcgtttacccttaatgatgtcatgcag
acagggagtaagaaatag

DBGET integrated database retrieval system