KEGG   Lates calcarifer (barramundi perch): 108896773Help
Entry
108896773         CDS       T04895                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00590  Arachidonic acid metabolism
lcf01100  Metabolic pathways
lcf04370  VEGF signaling pathway
lcf04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    108896773 (ptgs2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    108896773 (ptgs2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    108896773 (ptgs2)
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108896773 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase hEGF EGF
Motif
Other DBs
NCBI-GeneID: 108896773
NCBI-ProteinID: XP_018551532
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MNRLTFTVFLLALGFLVCEGGNPCCSEPCQNRGVCTALGPDNYECDCTRTGYYGQNCTTP
EFLTWLKVNLKPTPNAVHYLLTHFKGFWNIINNISFLRDAIMRYVLTSRSHLIDSPPTYN
SDYGYKSWEAYSNLSYYTRSLPPVPEDCPTPMGVVGKKELPDAKVLAEKLLMRRQFIPDP
QGTSLMFAFFAQHFTHQFFKSDMKKGPAFTQAKGHGVDLSHIYGDNLERQHKLRLFKDGK
LKYQIMDGEIYPPTVKEVGVDMHYPPHVPDSHRFAVGHEAFGLVPGLMMYATIWLREHNR
VCDVLKEVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRF
QYQNRIASEFNTLYHWHPLMPDSFHIEDTDYSYKQFVFNTSVVTEHGINNLVESFTKQIA
GRVAGGRNVPGAIMYVAIKSIENSREMRYQSLNSYRKRFNMKPYSSFEDLTGEKEMSAIL
EEMYGHVDAVELYPGLLVEKPRPNAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFG
GSVGFNIINTASLQKLVCNNVRGPCPVASFHVPNIKETGSMIINSSTSHSRGSDINPTVI
LKERTTEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaacagactcacatttacagttttcctattggcactgggctttcttgtgtgcgaagga
ggtaacccatgctgctcagagccatgtcagaacaggggagtttgcacagcactcgggcca
gataattatgagtgtgactgcacgcgcaccggatattatggacaaaactgcacaacacct
gagttcctcacctggctcaaagtgaatctgaagccaactcccaacgccgtccactacctt
ctcacccacttcaagggtttctggaacatcatcaacaacatctcatttctccgggatgcc
atcatgagatacgtgctgacatcccgatcccacttgattgacagtcctccaacttacaat
tcggattatggttacaaaagctgggaagcgtattccaacctttcctactatacgcgcagc
ctcccccctgtgccagaggattgcccaacccccatgggagtagtaggtaaaaaggagctg
cctgatgctaaagttttggctgagaagctcctgatgaggcgacagtttatcccggaccca
cagggcaccagcctaatgtttgcattctttgcacagcatttcacccaccagttcttcaaa
tctgatatgaagaaaggacctgcttttacccaggctaaaggtcacggggtggacctcagc
cacatttatggagacaacctggagaggcaacacaagctcagactcttcaaggacggaaag
cttaaatatcagatcatggatggggagatataccccccaacagtaaaggaagtgggtgtc
gacatgcactaccctcctcatgttcccgactctcaccgctttgctgtgggccacgaggcc
tttggcctggtccctggtctgatgatgtacgccaccatttggctgcgggagcacaaccgg
gtgtgtgatgtgctgaaggaggtgcaccccgactgggatgatgaaagactcttccagacc
acacggctcatcctgattggtgagaccataaagattgtaattgaggactacgtgcagcac
ctgagcggctaccacttcaagctcaagtttgaccccgagctgctcttcaaccagcgtttc
cagtaccagaaccgcattgcctcagagttcaacaccctgtaccactggcacccgctgatg
cctgatagtttccacattgaggatacagattacagctacaaacagtttgtcttcaacacc
tctgtagtgaccgagcatggcatcaacaacctcgtggagtcctttaccaagcagattgct
ggacgggttgctggtggtcgtaacgtccctggagctatcatgtacgtggccattaagtcc
attgagaacagcagagaaatgcgttaccagtctctgaattcctacaggaaacgattcaac
atgaagccctacagctcttttgaggacctgacaggagagaaagaaatgtccgcaatcctg
gaggagatgtacggacatgtggatgccgtggagctctacccaggcctgctggtggagaaa
cccagacccaacgccatcttcggagagaccatggtggagatgggggcccctttctccctc
aaaggcttaatgggaaaccccatctgctccccggagtactggaagcccagcaccttcgga
ggcagcgtgggcttcaacatcatcaataccgcctccctgcagaagctcgtctgcaataat
gtgcgtggcccctgtcctgtggcatcttttcatgtgcccaacatcaaagagacgggatcc
atgatcatcaactccagcacgtcccactcacgcggcagtgacatcaaccctacagtcatt
ttgaaagaaaggactactgagctctaa

DBGET integrated database retrieval system