KEGG   Lates calcarifer (barramundi perch): 108899706Help
Entry
108899706         CDS       T04895                                 

Gene name
pcsk1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     108899706 (pcsk1)
Peptidases [BR:lcf01002]
 Serine Peptidases
  Family S8: subtilisin family
   108899706 (pcsk1)
Chaperones and folding catalysts [BR:lcf03110]
 Intramolecular chaperones
  Subtilisin family
   108899706 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain
Motif
Other DBs
NCBI-GeneID: 108899706
NCBI-ProteinID: XP_018555833
LinkDB All DBs
Position
Unknown
AA seq 777 aa AA seqDB search
MEVRCRPAVMCCVFAVLCCAVPPSLASFYGDRQYLNEWAVEIPGGLAAARAIARELDYEL
VRQIGALEDHFLFRHRNHPSRMKRSADHITRKLSEDDRVLWAEQQYEKRRSKRASLGECR
DCPVDKLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWN
HTDIYSNYDAAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNS
KVGGIRMLDGIVTDAIEASSIGFNPNHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQ
KGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLAT
AYSSGDYTDQRITSADLHNECTQTHTGTSASAPLAAGIFALALEQNPDLTWRDLQHIVVW
TSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPATWKHVPEKKQCIVRDDS
FQPRELKAAGEITIEIPTKACAGQENAVRSLEHVQVEASIEYTRRGDLHITLTSPAGTST
VLLAERERDTSSNGFRNWDFMSVHTWGEDPAGTWTLKITDTSGRMENEGRILNWKLILHG
TSEKPEHMKKPRVYIPYNAVQNDRRGVEHMDDMMEEPTQAHPPPKTETAHASPSSNPEKV
PKNPTASLYSPSLALLRLLQTAFNRQIPAQQQPQAIARASSPVWRKQQQLDRSLTPPATR
LPPQKLYQALDLINKYRGPEDSVYSDYSDGFYSTKPYRHRDDRLLQALFEMIDDDRK
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgagatgtcgtccagcggtgatgtgttgtgtctttgccgtcctctgctgcgcg
gttcccccgtcgctggcgtctttttacggggacagacagtacctgaacgagtgggcagtg
gaaatcccgggcggactggccgctgcgagggcgatcgccagggaactggactacgaactg
gtccgacagattggggccctggaagaccatttcttgttcagacaccgcaatcatcctagc
agaatgaaacgaagcgccgaccacatcaccaggaagctgtcggaggatgatcgggtgctg
tgggcagagcagcagtacgagaaacgtcgcagcaagcgagcgtccctcggggagtgcagg
gactgccctgtggataagctgtttgatgatcccatgtggaaccagcagtggtacctgcaa
gacacccggacctcatcctcgctgccgaagctggacctgcatgtgatccccgtgtggcag
aaaggcatcacagggaaaggagtggtcatcaccgttctggatgacgggctggagtggaat
cacacagacatctactctaactacgacgcagcggccagctacgatttcaacgacaatgat
ccagacccctttcccagatatgactccactaatgaaaacaagcatgggaccaggtgtgcc
ggggaaatcgccatgcaggcagacaacaataaatgtggggttggagtggcatataactcc
aaggttggagggattcgtatgctggatgggatcgtgaccgacgccatcgaggccagttct
attgggttcaatcccaaccatgtggacatctacagtgccagctgggggcccaatgatgat
ggcaagacagtggagggccccggccgcctggcccagaaggctttcgagtacggtatccag
aagggccgcggtgggaaaggctctatctttgtttgggcgtcaggtaatggtggccgccag
ggcgataactgtgactgtgacggctacacagacagcatctacactatctcaatcagcagt
gcctcccagcagggcctgtccccctggtacgctgagaagtgctcctccactctggctaca
gcatacagcagtggagactacaccgaccagaggattacaagtgctgatctgcacaatgag
tgcactcagactcacaccggaacgtcggcctctgctccgctggctgcaggaatatttgcc
ctggcactggaacaaaacccggatctaacctggagagacctgcagcacattgtggtctgg
acctctgagttcgatcctttggccaacaatccaggctggaaaaggaacggagcgggactg
atggtcaacagccgctttggcttcggccttctgaatgctaaagccctggtggacctcgct
gacccagccacctggaagcacgtgccggagaagaagcagtgcatcgtcagggatgactct
ttccagccgagggagctgaaagcagcaggggagatcactatagagattccaaccaaagcc
tgtgcagggcaggagaacgcagtccgctcattggagcatgtgcaagtggaggccagcatt
gaatacaccaggagaggagatctgcacatcacgctcacctccccagccggtaccagcaca
gtgctgctggctgagcgagagagggacacgtcctctaacggcttcagaaactgggacttc
atgtccgtccacacatggggagaagaccctgctggtacatggacactaaagattacagac
acttcaggccgcatggagaacgagggtcgtattttgaattggaagctgatccttcatgga
acgtctgagaagccagagcacatgaagaaacctagagtgtacatcccctacaatgctgtg
cagaatgacaggcgtggtgtagaacatatggatgacatgatggaggagcccacacaggcc
cacccacctcctaagacagaaactgcacatgcttctccctcgtccaacccagagaaggtg
cccaaaaatcccacagcttcactttactccccctccctggccctgctgcgtcttctgcag
acagccttcaacaggcagatcccagcccagcagcagccccaggccatagccagggcctct
tcccccgtctggaggaagcagcagcagctggacagaagcctcactcctcccgctacaaga
ctcccccctcagaagctgtaccaggctctggatttgatcaacaagtaccggggccccgag
gacagtgtctacagtgactacagcgacggcttctacagcaccaagccgtacagacacaga
gatgaccgactgctgcaggccctgtttgaaatgatagatgatgaccgcaagtga

DBGET integrated database retrieval system