KEGG   Lates calcarifer (barramundi perch): 108900517Help
Entry
108900517         CDS       T04895                                 

Gene name
suv39h1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform X1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lcf00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108900517 (suv39h1)
Enzymes [BR:lcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108900517 (suv39h1)
Chromosome [BR:lcf03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108900517 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108900517 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 431 aa AA seqDB search
MAENLKDCLGVILEFCVWRLKEELSDYCRVPCKMSWDELEALCRRKGLHCKQLGVNKANV
NEYEVEFLCDYKKTKEEEFYLVKWRGFPELENTWEPKRNLRCPKLMKQFHLDLDEELRRH
KRRSIPKKLDKEVSSILVQKAKLRQSLQRWEAHLNHTRNHPGRIFVKNEVDLEGPPRNFT
YINNYEVGQGIVLDEMAVGCECKDCLEEPMNGCCPGASLHRMAYNDKGQIRIRPGQPIYE
CNSRCSCGPDCPNRVVQKGIQFDLCIFKTENGRGWGVRTLQHIKKNTFVMEYVGEIITTD
EAERRGQVYDRQGSTYLFDLDYVEDVYTVDATHLGNISHFVNHSCSPNLQVFNVFIDNID
ERLPRIALFSTRAIRAGEELTFDYKMQIDPVDTESTKMDSSFSLAGLPSSPKKRIRVECR
CGSDSCRKYLF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttgaaagactgtcttggtgtcatcctcgagttctgtgtttggcggttg
aaggaggaattatcagattattgcagggtgccttgtaagatgtcctgggatgagctggaa
gccctgtgtcgcagaaaggggcttcactgtaaacagcttggggtaaacaaagccaatgtc
aatgagtatgaggtggaattcctctgtgactacaagaagactaaggaggaagagttctat
ctggtaaagtggagggggttcccagagttggagaatacctgggaacccaagaggaacctc
agatgccccaaactgatgaaacagttccacttggaccttgatgaggagttgaggcgccac
aagagacgctccatccctaaaaagctagataaggaagtttcctcaatccttgtccagaaa
gccaaactacgtcagagtctgcagcgctgggaggcccatttgaatcatactcgtaaccac
ccaggtcgcatttttgtcaagaatgaagtggaccttgagggccccccaagaaacttcacc
tacatcaacaactatgaagtaggtcagggcatcgtgttagatgagatggctgtgggttgt
gagtgtaaggactgtttagaggagccaatgaatggctgctgtcctggagcctccttgcac
cgaatggcctataatgataaggggcagatccggatccgtccgggacagcccatatatgag
tgtaattcccgatgcagctgtggtcctgattgtcccaacagagtggtgcagaagggcatt
cagttcgacctgtgcatctttaagacagagaatggtagaggatggggtgtccgcacactg
cagcatatcaagaagaacacatttgtcatggagtacgttggagagatcatcacaacagat
gaagcagagaggaggggtcaggtgtatgaccgtcaaggttctacatacctgttcgacctg
gactatgtggaggatgtgtacacagtggatgcaactcacctaggcaacatctcccacttt
gtcaaccacagttgtagccccaacctgcaggtattcaatgtgttcattgacaacattgat
gagaggctcccaagaatcgcattgttttcaacacgggctattcgggcaggagaggagctc
acctttgactacaagatgcaaattgatccagttgacacagaaagcaccaaaatggactcc
agctttagtctagcaggactccccagctctccgaagaagaggattcgagtggagtgccgg
tgtggatcagactcttgtcgaaaatacctgttctaa

DBGET integrated database retrieval system