KEGG   Lates calcarifer (barramundi perch): 108900865Help
Entry
108900865         CDS       T04895                                 

Definition
(RefSeq) sialidase-4-like
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00511  Other glycan degradation
lcf00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lcf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    108900865
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    108900865
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     108900865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3
Motif
Other DBs
NCBI-GeneID: 108900865
NCBI-ProteinID: XP_018557645
LinkDB All DBs
Position
Unknown
AA seq 488 aa AA seqDB search
MRSPYFPARSVLFHKEPNGVTYRVPALLYLSHSRSFLAFCEERLSPSDSQAHLLVMRKGT
FYRNYVEWEDMRVLGTAFLMGHRSMNPCPVYDEFTGTLFLFFIAVLGHTSESYQLVTGKN
VTRLCYICSTDDGDTWTAVTDLTKRVIGDTIKEWATFALGPGHGIQLKSGRLLIPAYAYH
IECKECFGHLCQTAPHAFCFHSDTHGRTWRFGEAVPGPESVECQMVSVDEEDGTNVLYCN
ARSPLGYRVQALSLDDGAVFQEGQLVQRLVEPRNGCHGSTVGFPAPLHLRQSLNNHSHQP
KRRSRHWTSCSTHSNRSTSPSPTGPLSPNHRAPPDFLTPTWVVYSHPTWTTARKDLGVFL
SLFPRDPDSWRGPWVIYEGPSAYSDLAYLELPPSPGAPPAVAFACLFECGTKTAYDEICF
SIFTLYELIDNLPRDMQLGDEYKRQENQVSGTGRSCRHDAQGTPVFQQVPHVKKRRKKSK
LTELCSVS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgccctatttcccagcaaggtcggtgcttttccataaggagccgaatggagtg
acgtacagagtcccggcactgctctacctgtcccactccaggtccttcctggccttctgc
gaggagagactcagcccgtctgactctcaggctcacctgctggtcatgaggaaaggcact
ttctacagaaactatgtagagtgggaggacatgcgtgtccttggcactgccttcctgatg
ggccaccggtccatgaacccgtgtccggtttacgatgagttcacaggcactctcttcttg
ttcttcatcgctgttctgggccacacctcagagtcctatcagctggtgaccggcaagaac
gtgacccgactctgctacatctgcagcaccgacgacggagacacctggactgctgtcact
gacctcaccaagagagtcataggggacactatcaaagaatgggctaccttcgctctcggc
ccgggccacggtatccagctgaagtcaggccgcctgctcattcccgcctacgcctaccac
atcgagtgcaaggagtgcttcggccatctctgccagaccgctcctcacgccttctgcttt
cacagcgacacccacgggagaacctggcgtttcggggaggcggtgccgggcccggagagc
gtggagtgtcagatggtgtccgtggatgaggaggacgggactaacgtgttgtactgtaac
gcccgcagccctctgggctacagggtgcaggccctcagtctggacgatggagctgtgttt
caggagggacagctggtgcagcggctggtggagccgcgaaacggttgtcatggtagcact
gttggatttccggccccgctgcatctacgtcaaagtcttaacaatcactcacaccaacct
aaacgccgctccagacactggacgtcctgcagcacccactcaaatcgctccacctctccc
tctcccaccggccctttgtcacccaatcacagagcccctcctgatttcctcacccccacc
tgggtggtatactcccacccgacatggaccaccgcgcgcaaggacctgggcgtgttcctc
agcctatttccccgtgacccggacagctggcgcgggccctgggtgatctacgagggcccc
agcgcctactctgacctggcctacctggagctgcctccctcgcccggagcaccacccgcc
gtggccttcgcctgcctgttcgagtgcggcaccaaaacggcctacgatgaaatctgcttt
agcatcttcactctctacgagcttatcgataatctgcctcgggatatgcagctgggtgat
gaatataaaagacaggagaatcaagtctccgggacagggcggagctgtagacatgatgct
caggggacaccagttttccaacaggtgcctcatgtgaagaagaggaggaagaagagcaag
ttgactgagctgtgctctgtgtcttaa

DBGET integrated database retrieval system