KEGG   Leptothrix cholodnii: Lcho_2002Help
Entry
Lcho_2002         CDS       T00681                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
lch  Leptothrix cholodnii
Pathway
lch00250  Alanine, aspartate and glutamate metabolism
lch00280  Valine, leucine and isoleucine degradation
lch00410  beta-Alanine metabolism
lch00640  Propanoate metabolism
lch00650  Butanoate metabolism
lch01100  Metabolic pathways
lch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Lcho_2002
   00650 Butanoate metabolism
    Lcho_2002
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lcho_2002
   00280 Valine, leucine and isoleucine degradation
    Lcho_2002
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Lcho_2002
Enzymes [BR:lch01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Lcho_2002
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Lcho_2002
Amino acid related enzymes [BR:lch01007]
 Aminotransferase (transaminase)
  Class III
   Lcho_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACB34269
JGI: Lcho2002
UniProt: B1Y1H0
LinkDB All DBs
Position
2169080..2170384
Genome map
AA seq 434 aa AA seqDB search
MQREPHATNAALMARRRAALPAGLGQTYEVFVDHAENAEVWDVEGRRLIDFAGGIAVLNT
GHRHPKVIAAVKAQLDRQHHTCFQVLAYESYVELAERLIARTPGDFAKKAFFLSSGAEAV
ENAIKIARAATRRGAVIAFGGGFHGRTMMGMALTGKVAPYKTGFGPFPAEIYHAKFPNPL
HGVSTADALASVEAIFKYDVEAARVAAIILEPVQGEGGFYVAPIDFVRGLRAICDQHGTV
LIVDEVQTGAGRTGTWLACEQWVAAGVGAPDIVTMAKSMAGGFPISAVIGRAELMDAPGP
GGLGGTYAGSPLGCAAALAVLEVFEEENLLERSRDVGKRLTAGLQAIAARHKSIQDVRGP
GAMVAIELFKDGDLHQPDADLTKRICTEAIRRGLVLLSCGVHANVIRILVPLTASDAVID
EGLAILAASFDAVA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgtgaaccccatgccaccaacgccgcgctgatggcgcgccgccgtgccgccctg
cccgccggcctcggccagacctacgaggtgttcgtcgaccacgccgaaaatgccgaggtc
tgggacgtcgaaggccggcgcctgatcgacttcgccggtggcatcgcggtgctcaacacc
ggccaccgtcacccgaaggtgatcgccgcggtcaaggcgcagctggaccgccagcaccac
acctgcttccaggtgctggcctacgagtcgtacgtggaactggccgaacgcctgatcgcc
aggacgccgggcgatttcgccaagaaggcgtttttcctgagcagcggcgccgaggcggtc
gaaaacgccatcaagatcgcgcgcgctgccacccgccgcggcgcggtcatcgccttcggc
ggcggcttccacggccgcacgatgatgggcatggcgctgaccggcaaggtggcgccgtac
aagaccggcttcgggccgtttccggccgagatctaccacgccaagttcccgaacccgttg
catggcgtgagcacggccgatgcgctggcgtcggtggaggcgatcttcaagtacgacgtc
gaggccgcacgggtggcggccatcatcctggagccggtgcagggcgaaggcggcttctac
gtcgcgccgatcgacttcgtgcgcggcctgcgtgcgatctgcgaccagcacggcaccgtg
ctgatcgtcgacgaggtccagaccggcgccggccgcaccggcacctggctggcctgcgag
cagtgggtggccgcgggcgtgggcgcgcccgacatcgtgacgatggccaagtcgatggcc
ggcggtttcccgatctcggccgtgatcggccgcgccgagctgatggacgcgcccggcccc
ggcggcctgggcggcacctatgccggcagccctttgggttgcgccgcggcgctggcagtg
ctggaggtgttcgaggaagaaaacctgctggagcgcagccgcgacgtgggcaaacgcctg
accgccggccttcaggccatcgccgcacgccacaagagcatccaggacgtgcgcgggccg
ggcgcgatggtggcgatcgagctgttcaaggatggcgaccttcaccagccggatgccgac
ctgaccaaacgcatctgcaccgaggcgatccggcgtggcctggtgctgctgagctgcggc
gtccacgccaacgtgatccgcatcctggtgccgctgacggccagcgatgcggtgatcgac
gaaggcctggcgatcctcgccgcgagcttcgacgcggtggcctga

DBGET integrated database retrieval system