KEGG   Lactobacillus casei LOCK919: LOCK919_1398Help
Entry
LOCK919_1398      CDS       T02729                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lcl00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LOCK919_1398
Enzymes [BR:lcl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LOCK919_1398
Transporters [BR:lcl02000]
 Other Transporters
  Pores ion channels [TC:1]
   LOCK919_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_N_2 GST_N_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGP68097
UniProt: S4ZSL0
LinkDB All DBs
Position
1357264..1357893
Genome map
AA seq 209 aa AA seqDB search
MLKLFYASGTSAMAPHILLTDAGLNFELEKVNLDQKTWRGGDYDQINAKSYVPTLQIAPE
QYLTECAVILEYIDFQARQNDGSNYATDEYWQERVWLNYIATELHKNFISPFRKGNWLPN
TDDSKRLVWQRVAPRLAYVEARFQGPWLMGQHFSMTDPYLFVMTNWMHRLDFSFDHLPKL
KAFDERMRQRPSVQEVLRVEGKPHSVTDG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaattattttatgcttcaggaaccagtgcaatggcgccgcatattctactgact
gacgcgggacttaattttgagttggaaaaggtgaacttagatcaaaaaacttggcgcggt
ggcgattacgatcaaatcaacgccaagtcttatgtgccgaccttgcaaatagcgccagaa
caatacttaacagaatgcgctgtgattttagagtacattgactttcaagcccgacaaaat
gatggtagcaattatgccacagatgaatactggcaggagcgggtgtggctcaattatatt
gccacagaactccacaaaaactttatttcgccttttcggaagggtaattggctacctaat
acagatgatagcaaacggttggtgtggcagcgagttgccccgcgactagcttatgttgaa
gcacggtttcagggaccatggctaatggggcagcatttttcaatgacggatccttatctg
tttgtcatgacaaattggatgcaccggcttgatttttcatttgatcatttgccaaaatta
aaggcctttgacgagcgaatgcgacaacggccaagtgtgcaggaagttctgcgggtggaa
gggaagccgcacagcgttactgatggttaa

DBGET integrated database retrieval system