KEGG   Lactobacillus casei LOCK919: LOCK919_2574Help
Entry
LOCK919_2574      CDS       T02729                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00010  Glycolysis / Gluconeogenesis
lcl00260  Glycine, serine and threonine metabolism
lcl00680  Methane metabolism
lcl01100  Metabolic pathways
lcl01110  Biosynthesis of secondary metabolites
lcl01120  Microbial metabolism in diverse environments
lcl01130  Biosynthesis of antibiotics
lcl01200  Carbon metabolism
lcl01230  Biosynthesis of amino acids
Module
lcl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcl_M00002  Glycolysis, core module involving three-carbon compounds
lcl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOCK919_2574
  Energy metabolism
   00680 Methane metabolism
    LOCK919_2574
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LOCK919_2574
Enzymes [BR:lcl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LOCK919_2574
Membrane trafficking [BR:lcl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LOCK919_2574
Exosome [BR:lcl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LOCK919_2574
  Exosomal proteins of melanoma cells
   LOCK919_2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGP69252
UniProt: S4ZWH5
LinkDB All DBs
Position
complement(2533910..2534581)
Genome map
AA seq 223 aa AA seqDB search
MVKLVLLRHGESIANQKNTYTGWSDVGLTAEGKAQAETAGEKIASTGILFDHVHTSVLSR
AIMTAYIVQDKIGQNYLPITKSWRLNERHYGALRGINKDLTRKLFGPDQVASWRRSFSAH
PPLLANPSRTRRYHRYPATIIPRGESLADASQRLLPYWTAELAPRLLSEKNQLIVAHGST
LRALVKFMEDISNAGINKVEIGNAQPIVYTLDDKLTILDKQTL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaattagtcctgttaaggcatggcgagagcatcgccaatcagaagaatacttat
accggctggtcggatgtgggtttaaccgcagagggtaaggcacaggctgagacagctggg
gaaaaaattgcgtccacggggatcttgtttgatcatgttcatacgagcgtgctatcgcgg
gcaatcatgacggcatacatcgtgcaagataagatcggtcagaactacctgccgatcacg
aaaagttggcggcttaatgagcggcattacggtgccttacgtggtattaacaaggacttg
acgcgcaagctgttcggcccggatcaggttgcaagttggcggcgaagtttttccgcacac
ccgccattacttgctaatcctagtcgaacccggcgttaccaccgttatccagccacgatc
atcccgcgcggcgagagccttgccgatgcgagtcaacgattgttaccgtattggacagct
gaactggcaccgcgccttttgtccgagaaaaatcagctcattgtcgctcacggctctact
ttgcgcgccttggtgaagtttatggaagacatcagcaatgctggcatcaacaaggtcgaa
attggaaatgcccaaccaattgtttacaccttggatgacaagctaaccattctggataag
caaactttataa

DBGET integrated database retrieval system