KEGG   Latimeria chalumnae (coelacanth): 106701818Help
Entry
106701818         CDS       T02913                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106701818
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     106701818
Peptidases [BR:lcm01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106701818
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106701818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 287 aa AA seqDB search
MTPTISCLCKRCVPPVHFLFFAAATTTATTTLPPNLMEQLQKTLGSIIATVEALVAAPLE
DDDKIVGGYECRKNSVPYQVSLNAGYHFCGGSLIDNQWVVSAAHCYKSRIQVRIGEHNID
LSEGSEQYINAAKIIKHPRYSSRNMDNDIMLIKLSGPVSLNSYARAVPLPSSCAGAGTMC
LISGWGNTLSNGVNYPSMLQCLNAPILTTTQCQNAYPGMITNNMICIGYLEGGKDSCQGD
SGGPVVCNGQLQGVVSWGYGCADRNHPGVYTKVCNYVSWIRDTMARN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaaccatatcctgtctctgtaaaagatgtgttcccccagtccacttcctcttc
tttgctgctgccaccaccacagcaaccaccaccctcccacccaacctcatggagcagttg
cagaagacccttggatccatcatcgccactgtggaagccttggttgctgcgcctctagag
gatgatgacaagattgttggtggctatgagtgcaggaaaaactctgttccttatcaagtc
tccctgaatgctggttaccacttctgtggtggctctttgattgacaaccaatgggtcgtg
tctgctgctcattgctacaagtcacgtatacaggtacgaattggagagcacaacatcgat
ttaagtgaaggaagtgagcaatatatcaacgctgccaagattatcaaacatcctaggtac
agctcccgtaatatggacaatgatatcatgctgatcaagttatccggtcccgtttccttg
aattcctacgctcgagctgtcccactgccaagcagctgtgctggtgccgggacaatgtgt
ttgatctcaggctggggaaacacccttagcaatggagtgaactatccatccatgcttcag
tgccttaatgccccaattctgactaccactcagtgccagaatgcttacccaggaatgatc
accaacaatatgatctgcattggttatttggaagggggcaaggattcctgtcagggtgac
tctggtggccctgtggtctgcaatggacagcttcagggtgttgtgtcctggggatatgga
tgtgccgacaggaaccatccaggcgtttataccaaagtctgcaactacgtctcatggatt
cgtgacaccatggccaggaactaa

DBGET integrated database retrieval system