KEGG   Larimichthys crocea (large yellow croaker): 104920236Help
Entry
104920236         CDS       T04659                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
Enzymes [BR:lco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     104920236 (tmprss9)
Peptidases [BR:lco01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104920236 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 797 aa AA seqDB search
MEVKKDGGGPWSSSGASSAPSHHACYRSTLIAFFFFFLVIGVFVGLLLAYLVQEQHYFME
TVELRGLKYDPVLQDENSGYSIVLSSVLKSKIKNALTASSISQHYVDCSIVAYGNINGDV
MATFRLVFRVSKVQQYSDNFVQDLLRTGLSSAMHGKPLEVPDFGEINTIVLLGASGKSFY
AIGDEMIAKCPDNTFTCDNGECVTKLNPECDFITDCADGSDEARCACGTRPAMGTRVVGG
QDARRGELPWQVSLRLHGRHTCGASIINERWLVSAAHCFERDNNPREWTAMVGATQVSGE
EFTSKTVNIKSLTVSPHYNPMTTDNDVTVLELETPLTFNSYIQPVCLPSQSHVFAPGHSC
VVSGWGALNQFNAEVPPTLQKAVVKIIDSKVCNKSSVYRGTVTHNMMCAGFLQGKVDSCQ
GDSGGPLVCEGAPGRFFLAGVVSWGVGCAQINRPGVYSRVTRLRNWILSHTNPTLVHDYT
QFVPTVPVSLTGGNLNHPPVPKTTAMHVISAPIIPVLNCSGNFQCSTTSCITKINPECDG
VQDCPNRADEVNCDCGVRPALGSQRIVGGVTARRGEWPWIGSLQYQRLHRCGATLIHNKW
LITAAHCFKSDPSPTNWAVSLGSVLRSGVGALVIPIQRVIIHPAFNGTSMDHDVALLEMM
VPVPMSFTIQSVCLPSPVHRFLKTAECYITGWGSMREGGSLTNLLQKAAVNIIDDADCQQ
SYGNVLTPSMMCAGYMEGGRDTCLGDSGGPLTCRHLSGQWFIAGVTSWGHGCGRIGYPGV
YTRVTTIRKWISAYLPF
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaagaaggatggaggagggccgtggtcttcttcaggagcatcttctgctccg
tcccaccatgcctgctacagaagcaccctcatagctttctttttcttcttcctcgttatc
ggggtctttgtaggcctgcttcttgcgtatttggtgcaggagcaacattattttatggag
acagtggagctgagaggtctgaagtatgatcctgttctgcaggatgagaactctggttac
tccatagtactatcttcagttttaaagtccaagattaaaaatgccctaactgcctcatca
atatcacaacactacgttgattgcagtattgttgcctatggtaacattaatggtgatgtg
atggcaacattcagactggtcttcagggtgtctaaggtccagcagtattcagacaacttt
gttcaggacttgctgagaacagggctcagctcagcaatgcacgggaaaccactagaggtg
ccagattttggagagatcaacactatcgtcttactgggagccagcgggaagtcattttat
gctattggagatgagatgatagccaagtgtcctgacaacaccttcacgtgtgacaacgga
gaatgcgtcactaaactgaatccagagtgcgacttcatcaccgactgtgcagacggatct
gatgaagctcgttgtgcctgtggtacacgtcctgctatggggacccgggtggtgggtggt
caggatgctcggagaggggagctgccatggcaggtcagtctaaggctccatggacgtcac
acctgtggagcctccatcatcaatgaacgctggttggtcagtgcggcacactgctttgag
agggacaataaccccagagagtggacagccatggtaggcgccacacaggtgagcggtgag
gagttcacgtccaaaaccgttaacatcaagtcgctgactgtgtctccacactacaacccc
atgaccactgacaatgatgtcactgtgctggagctggagactcctctcaccttcaactct
tacatccagcctgtctgcctgccctcccaatctcatgtctttgcccctggacacagctgt
gtggtgtcaggatggggagccctgaaccagtttaatgctgaggtgcctccaacactgcag
aaggcagtggtaaaaataatcgactccaaggtgtgcaataaatcgtctgtgtacagaggt
actgttactcacaacatgatgtgtgctggattcctgcagggcaaggtggactcgtgtcag
ggtgactctggagggcctctggtttgtgagggggccccagggagattctttctggctggt
gtggtgagttggggtgtgggctgtgcccagatcaacagacctggggtttattcccgcgtc
accaggcttcgcaactggattctaagccacacaaatcccaccttggtccatgattacacc
cagtttgttcccactgtgccagttagcttgacaggaggaaacttaaatcatccaccagta
cccaagaccacagctatgcatgtaatatctgcaccaataatacctgtcttaaattgcagt
ggaaacttccagtgtagcaccacctcctgcatcaccaagatcaacccagagtgtgatgga
gtccaagactgccccaaccgggcagacgaagtaaactgcgactgtggtgtacgtcctgcg
ttggggtcacaaaggattgtgggtggagtaacggctcgaaggggggagtggccttggatt
ggcagtctccagtaccaaagacttcaccgatgtggcgccacgctcattcataacaaatgg
ttaatcacagcggcacactgcttcaaaagtgatccgagccccactaactgggccgtgagt
ctgggatctgtgctgcgttctggtgttggagccctggtcattcctatccagagggtcatc
atccacccagcctttaatggcactagcatggatcatgacgtggctcttttggagatgatg
gtcccagttcccatgtcattcacgattcagtctgtctgtctcccctcgccggtacaccgc
ttcctaaagactgcagagtgctacatcacgggctggggatccatgagggaaggaggttca
ttgaccaacctgctgcagaaagctgcagtgaacattattgatgatgccgactgccagcag
tcgtatggaaacgtgttgaccccaagcatgatgtgtgctggttacatggaaggaggcaga
gacacctgtttgggagactctggtgggccgctgacctgccgtcatctctccggccaatgg
tttattgctggagtgacaagctggggacatggatgtgggcgaattggttatccaggggtt
tacactcgtgtgacgaccatcagaaaatggatatctgcatatctgcctttctga

DBGET integrated database retrieval system