KEGG   Larimichthys crocea (large yellow croaker): 104920543Help
Entry
104920543         CDS       T04659                                 

Gene name
setdb1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lco00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104920543 (setdb1)
Enzymes [BR:lco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104920543 (setdb1)
Chromosome [BR:lco03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104920543 (setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    104920543 (setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1245 aa AA seqDB search
MESGERMEVDGWDPSLEEELGVSLDELKKWIEEAVEKSEIVQKKKAQLTELKEWVEQKEE
EKARTEVLLNDANQSILECEKLVKATYHRNGLVYRESSSEDEGVGGGVLSSEVIEIDDDD
DDDVIAVGCLVPPKKPGTPVKDPVVKEASAALQKTTQQVQKLAQMVSKPPGAPLLRPPPQ
SPSQSGIQSSVPSVFVSQVPSQSMTQPNPNIKQDELRVGMSILGKKRTKTWHRGTLVAIS
PVGNGIYKYKVKFDKGKSLLSGNHVAFDYNPTLEILYVGARVVAKYKDGNLVWLYAGIVA
EMPNNKNRMRFLIFFDDGYASYVTLPELYPVCRPLQRTWEDIEDASCRDFIEEYITAYPS
RPMVLLKVAQIIKTEWEGTWWKSKVEEVDGSLVKILFLDDKRSEWIYRGSTRLEPMFNLK
MTTANTQEKKLAGQQRTRPNMGALRSKGPVVQYTSDGHVGASPVKTPQSSPSQPSQTPQQ
QQQRPQPAQPQPTQQSPQLLQSVQPPQAPRVDNKHQMAKKSTSPFVPGIGGTHASKVMQS
LSSSPSNISSGRMLNAQNAGTPTFAQSYQRQLTPLAPAPPSVTHMATIPHQPAYRAPTDR
IFYLAHACQPACLNRVRPSKSDMHRGKNPLLTPLLYDFRRMTGRRKVNRKMSFHVIYKAP
CGLCLRNMAEIQHYLFQTRCDFIFLEMFCLDPYVLVDRPFQPQRPFYYINDITGGKEDIP
LSCVNEIDSTPPPKVAYSKERIPEDGVYINTSDDFLVGCECTDGCRDKSKCSCHQLTLQA
TGCTPGAQINPNAGYLHKRLEECLPTGIYECNKRCKCCAQMCTNRLVQHGLQVRLQLFKT
QNKGWGIRCLDDVAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGY
ESEAHCSDSEGSGVDVSRIKIPPSALVSSNPVGRPPRKGESNSKARSPSSSDESNEDDDK
DSKSEDESDSSDDTFVKDNYYNSSSVWRSYTTRGQAKGNKEGSQDSKDGLSVSAKGTDDE
KPPSMPEETGKSKVASWLTSQGLKKESGDSKSQVKSETGKKQDVMTLSDSDDVQTISSGS
DDNKEREKVTPGVTKKQVAVKSTRGIALKTGHGMMVKTGTPGGGGGPGGQGGKAGQQGQT
GGGGDNGPKNTRLFFDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPW
VAFFASKRIRAGTELTWDYNYEVGSVEGKVLLCCCGSTECRGRLL
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcggcgagcggatggaggtggacggctgggaccccagtctggaggaagaactg
ggcgtttctctagacgagctgaagaaatggatcgaagaggccgtggagaaaagcgagatc
gtgcagaagaaaaaggctcagctgacggagctcaaggaatgggtggagcagaaagaggaa
gagaaggcgaggacggaggtgcttctcaacgatgccaatcagtccatattggagtgcgag
aaactagtgaaggcaacttatcataggaatggtctcgtttaccgtgagagcagctcagag
gacgagggggtgggaggaggcgtgttgtcctctgaggtcatcgaaatagacgatgacgac
gatgacgacgtcatcgctgttggctgtttggttcctccaaagaagcctggcactcctgtc
aaagatccagtggtaaaagaggcgtctgcagctctacagaaaaccacccagcaggtgcag
aaattggcccaaatggtcagcaagccgccgggtgctccattgctcagacctccaccgcag
tctccatcccagtcaggtattcagagctcagtgccatcagtgtttgtatcccaggttcca
tctcagtccatgacccagccgaacccaaacatcaaacaagacgagctcagagtcgggatg
agcattttaggaaagaaacgcaccaagacatggcacagaggcactctcgttgccatcagc
cctgtcggaaatggtatatataagtataaagtgaagtttgataaaggaaagagcctgctg
tctggaaatcacgtggctttcgactataaccccaccctggagattctgtatgtcggggct
cgagtagttgccaagtacaaggatggcaacctggtgtggctctatgctggaatagtagca
gagatgcccaacaacaagaaccgtatgaggtttttgatcttttttgacgatggctatgct
tcatatgtgacactacctgagctttacccagtttgtcgaccattgcagcgtacctgggag
gacatagaggatgcatcgtgtcgagatttcatagaggagtacatcactgcctatcccagc
aggcctatggtgctcctaaaggtcgcacagatcatcaagacagagtgggaaggaacgtgg
tggaagagcaaagtggaggaggtggatggaagcttggtcaagatcctctttttggatgac
aagaggagtgagtggatctatagaggctccaccaggttagagccaatgttcaacctgaag
atgaccaccgccaacacccaggagaagaagctggcaggccagcagaggacacggcctaac
atgggagcgttgaggagtaaaggcccagtagttcagtacaccagtgacggacatgttgga
gcctcccctgtcaaaacaccacagtcctcacccagccagccttcacagacaccacaacag
caacaacaacgtcctcagcctgcacagccccaaccaacccaacaaagccctcagctttta
cagtctgtgcagcccccacaggctccacgtgttgacaataaacatcagatggcaaagaag
agtacttctccgtttgtccctgggataggaggcacacatgcctccaaagtcatgcagtct
ctttcctctagtcccagtaacatctctagtggaagaatgttaaatgcccaaaatgctggt
acgcccacgttcgcacagtcgtatcagagacagctaacccctctggctccggcccctcct
tctgtcacccacatggccaccatcccacatcagcccgcataccgtgccccgacggaccgc
atcttttacctggcacatgcttgtcagcccgcctgtctgaatcgtgtccgaccgtcaaaa
tcagacatgcatcgaggaaagaaccccctgctcacacctttactgtacgatttcaggcgc
atgacgggacgacgcaaagtcaaccgcaagatgtcctttcatgtgatctacaaggctccg
tgtgggctttgcctgcgtaacatggcggagatccaacactacctcttccagacgcgctgt
gactttatattcttagagatgttctgtctagacccttacgtgctcgtggaccggccattc
cagccacaaaggcctttctattatattaacgacatcaccggggggaaggaggacatccca
ctctcctgtgtcaacgagatcgattccacgccgcctcctaaagtagcttacagtaaagaa
cgtattcctgaagatggagtgtacatcaacaccagcgatgacttcctggttgggtgtgaa
tgcacagacggctgtcgagacaagtccaaatgctcttgccaccagctgacccttcaggct
acaggttgcacaccgggggcacagatcaacccgaatgctggatatttgcacaaacgatta
gaggagtgcctccctacagggatctacgagtgtaataagcggtgtaaatgctgtgcccaa
atgtgcaccaaccggttggtgcagcacggcctgcaggtgcgtctccaactcttcaagaca
cagaacaaaggctggggcatccgatgtctggatgatgtggccaagggctcctttgtctgc
atctatgctggtaaaatcttgacagacgactttgcagataaagaaggtctagagatgggt
gacgagtacttcgctaatctggaccatatagagagcgtggagaacttcaaggagggttat
gagagcgaggctcactgttcggacagtgaggggagcggggtggacgtgtcgaggataaaa
atcccaccatccgctttggtatcgtctaaccctgtggggcgaccgcccaggaagggtgag
tccaattccaaagcccgaagtccgagctcatcagacgagagtaatgaagacgatgacaag
gattcaaagagtgaagatgagagcgacagttcagacgacacgtttgtgaaagacaactac
tacaactccagctctgtgtggaggagttacaccacacgtggtcaggccaagggcaacaag
gaagggagtcaagacagtaaggatggcttgagtgtgtcagccaaaggaactgatgacgag
aagccaccgtccatgccagaggagacggggaaaagcaaagtggcttcctggcttaccagc
cagggacttaagaaggaatccggagacagcaagagtcaagtgaagtcagaaactgggaag
aagcaggatgtgatgactctgtccgacagtgatgatgttcagaccatcagctctggatct
gacgacaacaaggagagagagaaagtcaccccgggtgttactaagaagcaggtagctgtg
aaatctactcgaggcatcgccctgaagactggccacgggatgatggtaaaaacaggtaca
cctggaggtgggggagggccaggaggtcagggaggaaaagcaggacagcaaggacagact
ggaggaggaggagacaacggtcccaaaaacacccgtctgttctttgacggtgaagagtcc
tgctacatcatagatgccaagctggaaggaaaccttgggcgttacctcaatcatagctgc
agtccgaaccttttcgtccagaatgtgtttgtggacacacatgacttgcggtttccctgg
gtggcgttctttgccagcaagcggatccgggctggcacagagctgacctgggactacaac
tacgaggtgggcagcgtggaggggaaggtgctgctttgctgctgtggatccaccgagtgc
agaggcagactgttgtga

DBGET integrated database retrieval system