KEGG   Larimichthys crocea (large yellow croaker): 104923252Help
Entry
104923252         CDS       T04659                                 

Gene name
ace
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
Enzymes [BR:lco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     104923252 (ace)
Peptidases [BR:lco01002]
 Metallo Peptidases
  Family M2
   104923252 (ace)
Exosome [BR:lco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104923252 (ace)
CD molecules [BR:lco04090]
 Proteins
  104923252 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1283 aa AA seqDB search
MGTGVDRFLWTVLLLLPVLGHSEALTASWMPGNYDNTTAEALRFLNDYNSTAEEVLFFSV
SASWNYNTNITSHNSELQVNASLDEQAFAYAWGLKARAFPQSILDTLEPSDKKLMKKITL
LGAANLAPKEREEYNTILSTMDNIYSTAKVHPQPNISWSLEPELTDIMANSRSYKRLLYA
WEGWHNASGVPLKKYYPRFVELSNSASRSDGFTDTGDDWRSWYETQTFEEDLEELYRTIQ
PLYQHLHAFVRRKLYNQYGPKYINLKGPIPAHLLGNMWAQTWNNIYGLMIPFPEKPNLDV
TNEMINQRYNASHMFRVSEEFFTSLGLEKMPDEFWEGSMLVKPEGREVVCHASAWDFYNR
KDFRIKQCTTVTMEQLFTVHHEMGHVQYYLQYKDQPVGYRRGANPGFHEAIGDVLSLSVS
TPKHLKEINLLESATSDIQTDTNYLLKMALEKIAFLPFGYLIDQWRWSVFSGRTPPERYN
ADWWHLRTKYQGICPPTRRTEEHFDPGAKYHIPGNTPYIRYFVSFILQFQLHEKLCAAAN
QTGPLHTCDIYRSAAAGAILKKILQAGSSKPWPDVLQEAIGTRKLDANSLMKYFEPIIEW
LKKQNVNETLGWPDFNWVPPIPEGYPGDIDKNTDELDAKAFLAEYNSTAETVWNAYTEAS
WKYNTDINEQNKQAMLDKNLEMSAHTLKYGQKARLYDTTDFQDASTKRIIKKLSDIERAA
LSSEELKEYNNLLSNMETEYSVAQVCRPDKTCHPLDPDLQKIMAESRDYDELLFAWKGWR
DAAGKVIRQDYKRYVELANKAATLNGHSDNGAFWRSLYETPTFEEDLETLWKELEPLYQN
VHAYVRRALYKNYGPERINLKGPIPAHLLGNMWAQTWSGIMDLVMPYPDATQVDATPAMV
AQGWNPIRMFQESDRFFTSLGLLPMPPEFWNKSMLEKPSDGRQVVCHASAWDFYNRKDFR
IKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTPKH
LQSIGLLDKVESNHESDINFLMNMALDKIAFLPFGYLMDQWRWKVFDGRIPSTEYNKEWW
NLRMKYQGLCPPVTRTEDDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCEAANHVGP
LHTCDIYKSKEAGKLLGDVMKLGFSKPWPEAMAMITGQPKMTAQPLMQYFKPLIDWLETE
NNKNNEVRGWPEYDWKPLSSDPDPIKDNKVDFLGMNVDGSAATAGQWILLVLGIVLLVAT
ILLGYKYRKTKKREKSSSMMELK
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccggtgtggacaggtttctgtggacagtcctgctgctgttgccagtcttggga
cactctgaggctttgacagcaagctggatgccagggaattatgataacaccacggcagag
gcattaaggtttctaaatgactacaacagcactgccgaggaggtgttattcttcagcgtc
tctgccagctggaactacaacaccaacataacaagccacaactctgagcttcaggtaaat
gcatctcttgacgagcaggcctttgcatatgcatgggggctaaaagccagagcattccct
cagtccattctcgacactcttgaacccagtgacaagaaactgatgaaaaagatcacgctt
ctgggagctgccaacctggctccaaaagaaagagaggagtacaacacaattctgagcacc
atggacaatatttattcaacagccaaagtgcatccacagccaaacataagctggagcctg
gaacctgaactcacagatatcatggccaactccaggagctacaagaggctgctttatgca
tgggagggctggcacaatgcatcaggggtacctctcaagaagtactaccccaggtttgtg
gagctcagcaacagtgcctctcgaagtgatggttttacagacactggagatgactggcgc
tcttggtatgagacgcagacctttgaggaagatcttgaggaactgtacaggaccattcaa
cctctgtaccagcacctgcatgcctttgtacgccgcaagctctacaaccagtacggtccc
aagtacatcaaccttaaaggacccatccctgctcacctgcttggaaatatgtgggcccag
acctggaacaatatttatggtctaatgatcccatttcctgagaaacccaacttggatgtg
actaatgaaatgatcaaccaacgctataatgcctcgcacatgttccgtgtgtctgaggag
ttcttcacttctctgggattagaaaagatgcctgatgaattctgggagggatcaatgctg
gtgaagcctgaaggtcgagaggtggtgtgccatgcatccgcctgggacttttacaaccgc
aaagacttcaggatcaagcagtgcactacagtaacaatggagcagctctttactgtacac
catgagatgggacacgtccagtattacctgcaatacaaggaccagcctgtgggctatcgt
cgtggagccaaccctggtttccacgaagctattggcgatgttttgtctctctcagtttct
acacccaaacatctgaaagaaattaatctgctggaatctgcgacatctgatattcaaact
gataccaactacctgttaaagatggctttggagaagatagccttccttccctttggttac
ctcatcgaccagtggagatggagtgtgttcagtggacgcacacctccagagcggtacaat
gctgactggtggcacctcaggacaaaatatcaaggtatctgcccaccgaccaggcgtaca
gaggagcactttgatcctggggcaaaataccacatccctggaaacaccccatacattagg
tattttgtcagcttcatcctgcagttccagcttcatgaaaaactgtgcgccgcagccaat
caaaccggccccttgcacacatgtgacatataccgttccgcagcggcaggggccatttta
aagaaaattcttcaggctggctcctctaagccatggcctgacgtgctccaggaagctata
ggcaccaggaagttggatgctaactcactgatgaagtactttgagcccattattgagtgg
ctgaaaaaacaaaatgtgaatgagaccttgggatggcctgattttaactgggtcccaccc
atccctgagggctaccctggggatattgacaagaatacagacgagcttgatgcaaaggca
tttctggctgagtacaacagtacagctgagacggtgtggaatgcctacactgaggcctcc
tggaagtacaacaccgatatcaatgaacaaaataagcaggcgatgcttgacaaaaatctg
gagatgtcagcccacactctaaagtatggacagaaggcccgtctgtacgacaccactgac
ttccaggatgcctcgaccaaacgcatcatcaaaaaactcagcgacatcgagagggccgca
ctatcctcagaagaactgaaagagtacaacaatctcctatccaacatggagaccgagtac
agtgtggctcaggtctgcagacctgacaagacgtgccatccactggatccagatctccag
aagatcatggcagagtccagggattatgatgaattgttgtttgcctggaaaggatggaga
gatgctgctggcaaagtgattcgccaagattacaagagatatgttgaactggccaacaaa
gctgccacactcaatggacactctgacaatggggctttctggcgttccctgtatgaaacc
cctacctttgaagaagacctggagactctctggaaagagctggagccactctatcagaat
gtgcatgcatatgttcgcagagctttgtacaaaaactatggcccagagcgcattaacctg
aagggaccaattcctgctcatttgctcggcaacatgtgggcacagacgtggtctggcata
atggatttggtcatgccttacccagatgccacgcaggttgacgccactccagctatggtt
gcacagggctggaaccccatcagaatgttccaggagtcagacaggtttttcacctctttg
ggtcttctgccaatgccaccagagttttggaacaagtcgatgcttgagaagccgtctgat
gggcgacaggtggtgtgccacgcctctgcatgggacttctataacagaaaagacttcagg
atcaaacagtgtactgttgtgactatggatgacctgatcacagttcaccatgagatgggc
catgtgcagtacttcttacagtacaaagaccagcctgtgtccttccgcgatggagccaac
cctggcttccatgaggccatcggggatgttttagccctgtctgtttctacgcccaaacat
ctgcagagcatcggcctcctggacaaagtagaaagcaaccatgagagtgatatcaacttc
ctgatgaacatggcgcttgacaagattgccttccttccttttggctacttgatggatcag
tggagatggaaggtgtttgatggacgcatcccatcgactgagtacaacaaagaatggtgg
aacctcagaatgaagtaccaaggactgtgtccacctgtaacccgtactgaggatgacttc
gacccaggtgcaaagttccacatccctgctaacgtgccctatgtgaggtacttcgtcagt
ttcatcatccaatttcagttccacaaggctctgtgtgaagctgctaaccatgtgggccct
cttcatacctgcgacatctacaaatctaaggaagccgggaaactgctgggtgatgtgatg
aagcttggcttcagtaagccctggcccgaggctatggccatgatcactggccagcccaaa
atgactgcccagccactcatgcagtatttcaaacctctcattgactggctggagacagaa
aacaacaagaacaatgaggtccgcgggtggcccgaatacgactggaaacctttaagctcc
gatccagatccaattaaggataataaagtggacttccttggcatgaatgtggatggctca
gctgccacagctggccagtggatactgttggtccttggcatagtcctcttggtggccacc
atcctattgggctacaagtacaggaagacaaaaaagcgtgaaaagtcctcatccatgatg
gagcttaagtaa

DBGET integrated database retrieval system