KEGG   Larimichthys crocea (large yellow croaker): 104924489Help
Entry
104924489         CDS       T04659                                 

Gene name
ptgs1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    104924489 (ptgs1)
Enzymes [BR:lco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     104924489 (ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 902 aa AA seqDB search
MRSSVLGSVWAVLLLLREPACLGDEVTSSTVNPCCYLPCQHWGVCVRYGEDKYECDCTRT
GYFGENCTIPEFWTRVRQFLKPSPDVVHYILTHFRWLWDIVNYTYLRDVLMRLVLTARST
LIPSPPTYNSKYSYLSWESYYNLSYYTRILPPVPKDCPTPLGVKGKAGLPDPELLVERLL
KRRTFRPDPQGTNLMFAFFAQHFTHQFFKTYNRMGLGYTKAIAHGVDAGHVYGDNLERQL
QLRLHKDGKLKYQLIDGEMYPPSIADAPIRMNYPPGIPPEKQWAIGQEVFGLLPGLGMYA
TLWLREHNRVCDILKAEHPTWDDDQLFQTSRLIIIGETIKIVIEEYVQHLSGYLLKLKFD
PTLLFNSNFQYGNRIALEFSQLYHWHPLMPDSFIINGDEISYTQFLFNTSVLTYYGIDKV
VDAFARQTAGQIGGGHNINPVVTKVAVGTIKESRQLRMQPFNEYRKRFNLKPYTSFSEFT
DNEEIARELEEFYGDIDSVEFYPGLMLEKTRPGTIFGESMVEMGAPFSLKGLLGNPICSP
EYWKPSTFGGKVGFDIVNSATLKKLVCLNTKTCPYVAFRVPTEEQSQRENDELSVVMTTL
DDKILGEKLQYYYSSSEDEGSDNEDEDGENKTIRGANTEEPDIDYSADGSAVNTGPKGVI
NDWRKYKQLEVEQKQEQKREMERLIKKLSMTCRSDLDLEKDKEKEKELQDKIKGKMTMQE
YNMLQEEEDDEDFLQHYRMQRIEEMRRQLCRGKRFAQVYELNSGEDFLEALDKEDKSTLV
MIHIYETDVPGCEAMSGSLLCLAQEYPLVKFCSVRSSAISTSALFRDSALPALLVYKGGD
LIGNFVRLTDQLGEDFFAVDVEALLQEYGLLPDKPPLVPKTVRNGAIIQNTVSDEDSDLD
ID
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgagatcctctgttctaggatcagtttgggctgtcctcctgctcttgcgggagcctgcg
tgccttggtgatgaggttacctccagtacagtgaacccatgctgctatttgccctgtcag
cactggggtgtgtgtgtgagatacggcgaagacaaatatgagtgtgattgcactcgtacc
ggatacttcggagaaaactgcaccatcccggagttttggaccagagtgcgtcagttcttg
aagcccagcccagatgtggtgcattacattctcactcatttccgctggctctgggacatt
gtcaactacacctacctacgagacgttctcatgcgactggttctaacagctagatccacc
ttaatacccagccctccaacctacaactcaaaatatagctacctcagctgggagtcctac
tataatctgagctactacactcggattctgcccccagtgccaaaggactgtcctactccc
ctgggggtcaaaggcaaagctgggctgcctgaccctgagctgctggttgagaggctccta
aagagaagaacgtttagacccgacccccagggcaccaacctcatgttcgccttctttgcc
cagcacttcacccaccagttctttaagacctacaaccgcatgggacttggctacactaag
gctatagcgcacggggtggatgcagggcacgtttatggagacaacctggaacgtcaactc
cagctcaggcttcacaaagacggcaaactcaagtatcagttaattgatggcgagatgtac
cctccctctatagctgatgcacccattaggatgaactacccacctgggatccctcctgag
aaacagtgggctatcggccaggaggtgtttggcctccttcccggtttgggaatgtatgcc
acactgtggctgagggagcataaccgagtgtgtgacatcctgaaggcagagcatcccacc
tgggatgatgatcagcttttccagacgtcacgcctcatcatcattggtgaaacaataaag
atagtgatagaggagtacgtgcagcacctcagtggatacctgctgaagctgaaatttgat
cccaccctgctgtttaattccaacttccagtacgggaaccgtatcgctttagagttcagc
cagctctatcactggcaccctttgatgccggacagctttattatcaacggagatgagata
tcatacacgcagttcctattcaacacttcggttctgacatactacggcattgataaggtg
gtggatgctttcgctcggcaaactgctggccagattggcggtggtcataacatcaatcca
gtggtgaccaaagtggccgtggggaccataaaggagtcccgccaactccgcatgcagccc
tttaatgagtacaggaaacgctttaacctgaagccgtacacgtcattcagcgaattcacc
gataacgaggagatagcccgcgagctcgaagagttctacggtgacatcgactctgttgaa
ttttatcccggtttgatgttggagaaaaccagaccgggcaccatatttggagagagcatg
gtggagatgggcgcccccttctcccttaaaggcctgctgggaaaccctatatgttctcct
gaatactggaagccgagcacctttggaggtaaagtcggctttgacatagtgaactcggct
acgctaaagaagctggtctgtctgaacaccaagacgtgtccttacgtggcgtttagagta
ccaactgaggagcagtcccaaagagagaacgatgagctatctgtagtcatgacgactttg
gatgacaagatcctgggagagaagctgcagtactactacagcagcagcgaggacgaaggc
agcgacaacgaggacgaggacggggagaacaagaccatccggggtgcgaacacagaagag
ccggacatagactacagcgcagacgggagtgctgtcaacacaggaccaaagggagtcatc
aatgactggaggaagtacaagcagctggaggtggagcagaaacaggagcagaagagggag
atggaaaggctgattaagaagctgtcgatgacgtgccgctccgacctcgacctggaaaaa
gacaaggagaaagagaaagagctgcaggacaaaataaaaggcaaaatgaccatgcaagag
tacaacatgcttcaggaagaagaggacgacgaggacttcctccagcattaccgcatgcag
cgcatcgaagagatgcggcgccagctctgccgcggcaagcgcttcgcgcaggtctacgag
ctcaacagcggcgaggacttcctggaggctttggacaaggaggacaaaagcacgctggtc
atgatccacatctacgagacggacgtcccgggctgcgaggccatgagcggcagcctgctc
tgtctggctcaggaatacccgctggtcaagttctgtagcgtacgcagctcggccatcagc
accagcgcactgttcagagacagcgctctccctgctctgctcgtttacaaaggaggggac
ctgatcggcaacttcgtgcggctcacagatcagctcggggaagacttcttcgctgtggac
gtggaggctctgctgcaggagtacggcctgctgcccgacaagccccccctcgtcccgaag
acggtccgcaacggagccatcatacagaacactgtgagcgatgaggactctgaccttgat
atagactag

DBGET integrated database retrieval system