KEGG   Larimichthys crocea (large yellow croaker): 104926795Help
Entry
104926795         CDS       T04659                                 

Gene name
nsd2, whsc1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lco00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104926795 (nsd2)
Enzymes [BR:lco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104926795 (nsd2)
Chromosome [BR:lco03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104926795 (nsd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 104926795
NCBI-ProteinID: XP_019133573
LinkDB All DBs
Position
Un
AA seq 1402 aa AA seqDB search
MDSKGSSLPSMPEPANPISMKQPPESLSVRKGGGDMSSDPALLIDKAAAQLAATLQDGVL
QKVAGYSHNNHSHERLKDLTSRVLNGDQDTLPKLCAPEPPMLKGAEVPATNGTHQHNCTP
HPEPELKATIPQVVKQPLFEPFCANGTSLSATTEDTISGSEKRQDAKKRRGRPYKPKHQP
NLGSSPVPAETLDHTDAVDETEAADEPDLIPELTEEATEESTEESPQESPQVSPLLTCFS
VGELVWTKVSGYPWWPCMVTTDPESNSHFKQKQKVASSRSGVLYHVQYFGDAPERGYIFE
KNMVSFTGEDQYHELSQGNKQPPSRVIHKKTAASVPHKLQAQWNMGVIQAKEALSMSLDE
RMANFAFLYDDDGPHLNPHIMEKLKPEQSNEQEQETESRLSPDLPSLLADSAVHPAAAPQ
SQDSTSSGKKTQAPRTKLKTGGWQKIGKGHLNDFLSKNKLNDAVSSKAELHPQSASQDAT
TSAPDIQAESVIPQKKRRRSKQAQSPTKTVRRRKKPAAANTSDPASKRKSKLVSSTEDVS
EPVSLPVSVPVKRERKKTSKRPLADAAADKDQQPKRRRKTSKDAEKQALTSEGTEKKQRR
RRKKTDKDLKETKQRRKKSTTLLTDDQDAEKPKRRRKRKQDGESQATPSKAKKRRSSPCP
DPEGSGSEGRPDSPSDSLDGTKKGERKKEFVCQTCEQAGEDLVPCEGQCCGMFHLHCLGQ
SFKPDEKLLCQECSTGIHSCFNCKQSDGAVRRCHVPHCGKFYHEACIRLNPLTVFDNKGF
RCPLHTCLGCHYGCRTKHKATKGRLMRCLRCPVAYHVGDLCVAAGSEMITNTAIICTNHF
NAKKGYSHHSHVNVSWCFVCSKGGQLLCCESCPAAFHPDCLNIAMPDGSWFCNDCRAGKK
PKYRDIIWVKLGTYRWWPAEIHHPRSIPTNIQHLRHEIGEFPVFFFGSKDYFWTHQGRVF
PYMEGDRGSKHQRTGIGKVFKNALSEAEVRFKEIKMKREAKEAQENSRKPPPYKFIKVNK
PFGKVQVYTADISEIPKCNCKPTDERPCGFESECLNRMLQYECHPQVCPSGERCCNQDFT
KRLYPETKIIKTPGKGWGLVSLRDIKKGEFVNEYIGELIDEEECRARIKFAQENNITDFY
MLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETQKWTVNGDTRVGLFAVCDIPVGTELTFN
YNLDCLGNEKTVCRCGAPNCSGFLGDRPKNSNGQAAEPKGKRVKRKYKKRKAEGKKKSED
ECFRCGDGGQLVLCDKKTCTKAYHLSCLNLTKRPFGRWDCPWHHCDVCGKNSEAFCQLCP
NSFCKVHQEGALRPWPATGQLCCLEHDELEGTDSQDQDVNSEANETTTATTAAIAGRPPK
GSRKAEGAEAKAKGSKRKAAEA
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaaaggtagttccctgccttccatgcctgaaccagccaacccgatcagcatg
aagcagccgccagagtcgctcagtgtacggaaaggtgggggggacatgagcagcgaccca
gctctgttaattgataaagctgctgcccagctggccgccacactacaagacggcgtcctt
cagaaggtggctggctacagtcataacaaccacagccacgaaagactcaaagacttgacc
tctcgcgtgctgaacggggaccaagacacgctgcctaagctttgcgctccggagccgccc
atgctgaagggcgccgaggtccccgcgacgaacggcacccatcagcacaactgcactcct
catcccgaacccgagctgaaggcgacgataccgcaggtggtcaagcagccgctgttcgag
cccttctgtgccaacgggaccagtttgtccgcgaccacagaagatactatatctggatcg
gagaagagacaggacgcgaagaagaggagggggcggccttacaaaccaaaacatcaaccg
aacctcggctcctctcccgtccccgcggagacactcgaccacacagacgccgtggacgag
actgaagcagcggatgagcccgatctcatcccggagttaacggaggaggctacagaggag
tccacggaggagtcccctcaggagtctcctcaggtgtctcctctgctgacctgcttctct
gttggtgagctggtttggaccaaagtgtcagggtacccctggtggccttgcatggtgacc
acagacccagaatccaacagtcacttcaaacagaaacagaaagtagccagcagcaggtca
ggtgtcctttaccatgtgcagtattttggagacgccccggagagaggctacatcttcgag
aagaacatggtgtcctttaccggagaggatcaataccacgagctcagccagggcaacaaa
cagccgccgtcccgcgtcatccacaaaaagacggctgcttccgtgccccataaactccag
gctcagtggaacatgggcgtcattcaggccaaggaggccctcagcatgtcactagacgag
cgcatggcgaacttcgcgtttctgtacgatgacgacgggcctcacctgaacccccacatc
atggagaagttgaagccagaacagagcaacgagcaggagcaggaaacggagtccaggcta
agcccagatctcccctcgctgctggccgactccgccgttcaccccgcagccgcccctcag
tcccaagacagcacttcatcagggaaaaagacacaagcgcccagaacgaaactcaaaacg
ggaggatggcagaaaattggcaaaggccacttaaatgatttcctgtcgaaaaataaattg
aacgacgcggtttcttccaaagcagagcttcatccacagtcagcctcacaggatgccacc
acttctgcaccagatattcaagctgaatcagtcatacctcagaagaaaaggaggagatcc
aaacaggctcagtctcccacgaagactgtgaggaggaggaaaaaacccgcagcagccaac
acctctgaccccgccagcaaaaggaaatcaaagcttgtttcttcgactgaagatgtttca
gaaccggtctcgcttccagtttcagttccagtgaagcgggagcggaagaagacttctaaa
aggccgctcgcagacgccgcagcagacaaggatcagcagcccaagaggagacgtaaaacc
agcaaagatgctgaaaaacaggccttgacttcagagggaacagagaaaaagcagaggagg
aggaggaagaagactgacaaagacctgaaagaaaccaagcagcgacggaaaaagtcgacc
acgctcctcactgatgatcaggatgcagagaaaccaaaacgtcggaggaaaaggaagcag
gatggagagagccaggccacgccctccaaggcaaagaagaggcggtcctcgccgtgtcct
gatcccgagggctcggggagtgaaggacgtcctgattctccaagcgacagcttagacggg
acgaagaaaggcgagcggaagaaggagttcgtctgccagacgtgtgaacaggccggtgag
gacctggtgccctgtgaaggtcagtgctgtgggatgtttcacctccactgtctgggtcag
tcattcaaacccgacgagaagctgctgtgtcaggagtgcagcacaggaatccactcgtgt
ttcaactgtaagcagtcggacggcgccgtgcgtcgctgccacgtcccgcactgcggcaaa
ttttaccacgaggcgtgcatccgcctcaacccgctcaccgtgttcgacaacaagggcttc
cgctgcccgctccacacctgcctgggctgccactacggctgccgcaccaagcacaaggcc
accaaaggtcgtttgatgcgctgcctgcgctgtcctgtggcgtaccacgtcggtgacctg
tgcgtggctgcgggcagtgagatgatcaccaacactgccatcatctgcacgaaccacttc
aacgccaagaagggctacagccaccacagtcacgtcaacgtcagctggtgcttcgtctgc
tccaaaggagggcagctgctgtgctgcgaatcctgtccagccgctttccaccccgactgc
ctgaacatcgcgatgcctgatgggagctggttctgcaacgactgccgggccggaaagaaa
cccaaatacagagacatcatctgggtcaaactgggaacatacagatggtggcccgcagag
atccaccaccccagaagcatccccaccaacatccagcaccttcgacacgagatcggagag
ttcccggtcttcttcttcggctccaaggattacttctggactcaccagggccgagtgttt
ccgtacatggagggagaccgaggcagcaagcaccagaggaccggcatcggcaaagtcttc
aagaacgcgctgtcggaggctgaagttcgattcaaggagataaaaatgaaacgagaggcc
aaggaagctcaagagaacagccggaaaccgccaccgtataaatttatcaaggtcaacaaa
cccttcggtaaggttcaggtctacaccgcggacatctccgagatccccaagtgtaactgc
aagccgacagacgagcggccgtgcggcttcgagtccgagtgtctgaaccgcatgctgcag
tacgagtgtcaccctcaggtgtgtcccagcggcgagcgctgctgcaaccaggacttcacc
aaacgtctctacccggagaccaagatcatcaagacgcccggcaaaggctggggcctggtg
tctctgcgggacatcaagaagggcgagttcgtgaacgagtacatcggagagctgatcgac
gaggaggagtgcagggcgaggatcaagttcgctcaggaaaacaacatcaccgacttctac
atgctcaccatcgacaaggaccggatcatcgacgccggtccgaaaggaaactactctcgc
ttcatgaaccacagctgtcagcccaactgtgagacgcagaagtggacggtgaacggcgac
acgcgggtcggcctgttcgccgtctgcgacatcccagtaggcaccgagctgaccttcaac
tacaacctggactgtctcgggaatgagaagacggtctgtcgctgcggcgctccaaactgc
agcgggtttctcggtgatcgaccgaagaactcaaacggtcaagcggccgagcccaaaggg
aagagggtgaagagaaagtacaagaagaggaaagcggaggggaagaagaagtctgaggac
gagtgtttccgctgcggggacggaggacagctggtgctgtgcgacaagaagacctgcacc
aaagcgtaccacctgtcctgcctgaacctcaccaagagaccgtttggccgctgggactgc
ccctggcatcattgtgacgtctgcgggaaaaactcggaggccttctgccagctctgcccc
aactccttctgcaaggttcaccaggagggggcgctgcgtccctggcccgccacgggacag
ctgtgctgcttggagcacgacgagctggaaggaacggacagccaggaccaggacgtcaac
tccgaggccaacgagacgacgaccgccactactgccgccatcgctggccgtcctccgaaa
ggctccaggaaggcggagggagccgaggccaaagcgaagggctccaagaggaaagcagca
gaggcctga

DBGET integrated database retrieval system