KEGG   Larimichthys crocea (large yellow croaker): 104929894Help
Entry
104929894         CDS       T04659                                 

Gene name
hdac7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
Enzymes [BR:lco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     104929894 (hdac7)
Chromosome [BR:lco03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     104929894 (hdac7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1029 aa AA seqDB search
MFTPQTDGISTSGYIIKTDRQDNIYHTVADSSVAVPVSFAALFPMDLRVGERGMRPGSDT
ALLTPLHPPLLLGPLPPHSRPSFSQQQLHQHIRFNMEQRRREQEQHEKQQELQQLKHKDK
SQQSAVASSVVKQKLQQVILNKQKQAALERTNSNTLSAPPVPYRKLGPDPSLSSQPLVSS
PSQPSSESSEGTPLRRAASEPNLKVKHKLKKHLNTRKSPLTRKESAPPSVKHRVPDTLDS
SPSSSSTPVSGCSSPNDSLPNENGLLPSAGGLSHEAQKLLLRDGTLANFTIQSPSTLPTI
TLGLPANARVNTELQQMSVVTTHLFLNDIFSLKQVEGELSSMKLSRVPVVTAGGSQVFLP
LSREDQAGQLNPHLPVIILEPSGLVHTPLLTVPGLDTVPLQFAPQLDHLSPVGAQPHKPL
SRTRSEPLPQSPRTLHTHLLQQQHNTQLLERLKQQTHLGKLMSKPSEKPRLHQIPSEDMD
SEDGGGTSPTEPTYQSRVRAESLREAEPTASKSQEEQINLQHALILNQSLLWEQQKQLQQ
LHRQMETLAVPMLRGTGGVGSGLGVHRPLSRTQSSPASTSLTLPEKPLSLDTSSKPRFTT
GLVYDSQMLKHQCTCGDNSSHPEHAGRIQSIWSRLQERGLRGQCESIRGRKATLEELQSV
HTERHVLLYGTNPLNRLKLDNRKLAGILSQRMFVMLPCGGVGVDNDTTWNESHTSTASRM
AAGSVVELAFRVAKGELKNGFAVVRPPGHHADPSNPMGFCYFNSVAIAAKQLQHKLSVSK
ILIVDWDVHHGNGTQEVFYSDPSVLYISLHRYDDGNFFPGSGSPAEVGSGAGEGFNVNVA
WTGGLDPPMGDAEYLAAFRSVVMPIAQEFSPDVVLVSAGFDAAEGNPAPLGGYKVSAKCF
SFLTRQLMSLAGGRLVLALEGGHDLTAICDASEACVSALLGIQDPLAEEVLLQKPNANAV
RSLQTVIQIQSQYWQSVKPYSGSVGLSYLSAQRRDCEETDAVNALASLSVGVLSNKSLPD
EPMDDSDSM
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaccacagactgatggaatcagcacctctggttacatcataaagaccgacaga
caggacaacatatatcatacagtggcagattcctctgtggcagtgccggtgtcgttcgcg
gctttatttcccatggacctcagggtgggagagcggggcatgcgccccggttcggacacg
gcactcctcaccccgctgcacccgcctttactcctcggcccattaccccctcattcccgc
ccctccttctcccagcaacaactgcaccaacacatccggtttaacatggagcagaggagg
cgagagcaggagcagcatgagaaacaacaggagttgcagcagctaaaacacaaagacaag
agtcaacagagtgcggtggccagttctgtggtgaaacagaaactccagcaggtgattctc
aataagcagaaacaggcggcgctggaaagaacaaactccaacactctgagtgcacctcct
gtaccatacagaaagctgggtccagaccccagtttatcgtcccagcctctggtctcgtct
ccctcacagccatcctctgagagttcagaggggacgccgctacgcagagcagcgtctgag
cccaatctgaaggtgaaacacaagctgaagaaacatctaaacacccgcaaaagcccgctc
acccgcaaagagagtgccccgcctagtgtcaaacacagagtacctgacacactggactcg
tcccccagcagcagcagtactccggtctctggctgtagttctcctaatgacagtctaccc
aatgagaatgggctactgccatctgcaggcggcctctcacatgaggcccagaagctgctg
ctcagagatggaactctagctaacttcaccatccagagtccctccactctgcccaccatc
acgctgggactaccagccaacgccagggtaaacactgaactgcagcagatgtctgtcgta
acaactcatttattcttgaatgatatcttttccctcaaacaagttgaaggagagctgtcc
tcaatgaaactcagccgggtgccagtggtcacagcagggggctcacaggtcttcctcccc
ctgagcagagaggatcaggccgggcagctgaaccctcacctgcctgtcatcatcctggag
ccctctggattggtacacactcctctactcactgttccaggtctagacaccgtcccgcta
cagttcgcacctcagttagaccacctttctcctgtaggtgctcagccccacaagcccctg
agcagaacacgctcagagcccctcccccagagcccgcggacccttcacacacatcttctc
caacaacagcacaacacacaactactggagaggctcaaacagcaaactcacctgggcaag
ctgatgtctaaaccgagcgagaagcccagactgcatcagatcccctctgaggatatggac
tcagaggatggtggtgggacgtcacccacagagccaacctatcagagcagagtgagggca
gagtcactgagggaggcggagccaacagcatccaagagccaggaagagcaaataaacctg
caacatgcactcatactcaaccagtcgttactgtgggaacagcagaaacagctacagcag
ctgcatcgacagatggagaccctggcagtacccatgttacgcggcaccggtggggttggt
agtgggctgggggtccatcgacccctgtcacgaacacagtcttccccagcctccacctct
ctcactctgcctgagaaacccctgagtctggataccagcagcaaaccacgcttcactact
ggcctggtatatgattctcagatgctgaagcaccagtgtacatgtggagacaacagcagt
cacccagagcatgctgggagaatacagagcatctggtcccgactacaagagagaggcctg
aggggacagtgtgagagtattcgaggccgtaaagccactctggaggagctgcagtcagtc
cacacagagcgccatgtgttgctgtacggcaccaacccactcaacagactcaaactggat
aaccgcaaactggccggaatcctctctcaaaggatgtttgtgatgttaccgtgtgggggt
gtaggggttgataatgacaccacctggaatgagtcgcacacctctacagcatcacgtatg
gcagcaggcagtgttgtggaactagccttcagagtggccaaaggagaactcaagaacggc
tttgctgtggtcagaccaccagggcatcacgcagacccctccaatccaatgggtttctgt
tacttcaattctgtggccatagccgccaagcagctccaacacaagctcagcgtcagcaag
atcctcattgttgactgggatgttcaccatggcaacggcacccaggaagtgttctacagc
gaccccagcgttctctacatctcgctgcaccgctatgacgacggaaacttcttccctggc
agtgggtcaccagctgaggtcggttcgggagcaggcgaaggcttcaatgtgaatgtggca
tggacaggaggactggacccacccatgggagatgcggagtacctcgctgcattcaggtct
gtggtgatgcccatcgcccaggagttctctccggatgttgttctggtttcagctgggttt
gatgccgctgaaggaaatccagctcctctaggagggtacaaggtctccgccaaatgtttc
agcttcctgacccgtcagctgatgtctctagcaggaggtcgtctggttttggcccttgag
ggaggtcacgacctaactgctatctgtgacgcatctgaagcctgtgtcagtgcactcctg
ggcatacaggacccactggcagaagaagtcctactccagaagcccaacgctaatgcagtc
cgctctctgcagactgtcatacagatacagagccagtattggcagagtgtgaagccttac
agtggatcagtgggtctgtcctatctgtctgctcagagaagagactgtgaggaaacggat
gctgtcaatgcgttggcctcactctctgtgggagtcctttccaacaagagcctccctgac
gagccaatggacgacagtgactccatgtag

DBGET integrated database retrieval system