KEGG   Larimichthys crocea (large yellow croaker): 104930339Help
Entry
104930339         CDS       T04659                                 

Gene name
tufm
Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
Translation factors [BR:lco03012]
 Eukaryotic Type
  Elongation factors
   104930339 (tufm)
 Prokaryotic Type
   104930339 (tufm)
Mitochondrial biogenesis [BR:lco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    104930339 (tufm)
Exosome [BR:lco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104930339 (tufm)
  Exosomal proteins of breast cancer cells
   104930339 (tufm)
  Exosomal proteins of colorectal cancer cells
   104930339 (tufm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 104930339
NCBI-ProteinID: XP_019129814
UniProt: A0A0F8CCZ2
LinkDB All DBs
Position
Un
AA seq 447 aa AA seqDB search
MASLVGLRACFSALQLTSPGLLHSSFKLCAVPLSRRTFAAEAKKTYSRDKPHVNIGTIGH
VDHGKTTLTAAITKVLADAGGANYKKYEDIDNAPEEKARGITINASHVEYTTANRHYAHT
DCPGHADYVKNMITGTAQMDGCILVVAATDGQMPQTREHLLLARQIGVEHVVVFINKADV
VEDKEMLELVEIEIRELLTEFGYDGENTPVVIGSALCALENREPDLGMNAVLKLLEIVDS
YVPLPKRDMDKPFLLPVEGVYSIPGRGTVVTGTLERGIIKKGDDAEFVGHNRLFKSVVTG
IEMFHKSLDRAEAGDNLGALVRGLKREDVRRGMVMCKPGSIKPHQKVKAQVYILSKEEGG
RHKPFVSNFIPVMFSLTWDMACRITLPADKEMVMPGEDTSLMLTLRQPMVLEKGQRFTLR
DGNKTIGTGLVTDILTVTEEDQVDWGN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcttgtgggactgcgcgcatgtttctccgccctccagctcacctcgccgggc
ctcctgcacagctccttcaaattgtgtgctgtgcctctgagtcggcggacctttgctgca
gaggctaagaagacgtacagcagagacaagccccatgtaaacatcggaacaattggccat
gttgatcacggcaagacgaccctgactgcagccatcacgaaagtgctcgctgacgctggt
ggtgctaactataaaaagtatgaagacattgacaatgcccctgaagagaaggccagagga
atcaccatcaacgcctctcatgtagaatacaccacagccaacaggcattatgctcacacg
gactgtcctggtcatgctgactacgtcaagaacatgatcacaggcacagctcagatggac
ggctgcatcctggtggtggcggccaccgatggtcagatgcctcagacacgagagcatctc
ctgttggccaggcagattggtgtcgagcatgtggtggttttcatcaacaaggctgacgtt
gtggaggacaaagagatgctggagctggtggagatcgagatccgtgagctgctcacagag
ttcggctatgatggcgagaacacacctgttgtaataggctcagccctctgcgccctggag
aacagagagcctgacctcggtatgaatgcagtgttgaaactgctggagattgttgattct
tacgttcctctgcccaaaagagatatggataaacctttcctcctgcccgttgaaggagtt
tattccatcccaggcagaggtacggtggtgacgggcactttggagaggggtatcatcaag
aaaggagatgacgctgagtttgtcggccacaatcggctcttcaagtccgtcgttacaggt
attgagatgttccacaagtctctggatcgggcagaggcaggagataacctgggcgctctg
gtccgaggactgaagagggaggacgtgaggagagggatggtgatgtgcaaaccgggatcc
atcaagcctcaccagaaagtcaaggctcaggtgtatattctgagtaaggaggagggaggc
aggcacaaaccatttgtgtccaacttcatacccgtgatgttctctctgacctgggacatg
gcctgcagaatcactctgcctgctgacaaggaaatggtgatgccaggggaggacacctcc
ttgatgctcacactgcgccagccgatggttctggaaaaaggccagaggttcactctgaga
gatggaaacaaaaccatcggcaccggcctggtcacagacatcttgacagttacagaagaa
gaccaggtcgactggggaaactga

DBGET integrated database retrieval system