KEGG   Larimichthys crocea (large yellow croaker): 104931855Help
Entry
104931855         CDS       T04659                                 

Gene name
tgm1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
Enzymes [BR:lco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104931855 (tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 785 aa AA seqDB search
MPGERLTVRGTSDVGRFPGAAPPTRVELTIQKDEKKQEEGGCRRWFRKMCPCCCKRQNSS
SYDITDKVELVKPPTPAVIPVPEPVKPKPENGEAREMEEIKLSVVSVDLLSSKTDQNRLE
HRTDLYHGEDLIIRRGQPFHMEMELNRPFNAENDKLHLDLKTGPLPMVSKGTHVIIPLVD
NPEDKHWKGKIVEQNGNKIKLSISSPATAVCGLYGLTVTSSSSKDEPATTHDCSKNIVIL
FNPWCEEDTVFLDDEEERNEYVLNDIGRIYYGTEKQIGARTWNFGQFHEGILEACLFILE
KSDMPASGRGDPINMVRVISAMINAQDDYGVLVGNWSGDYSDGVSPSAWSSSVEILRKYH
STNGIPVSYGQCWVFSGVTTTVLRCLGIPARSVTNFQSAHDTDVSLTTDVYFDENLDPID
YLNSDSVWNFHVWNDCWMARPDLPPGNGGWQAVDSTPQETSQGTFRCGPASLNAIRSGEV
YLKHDSPFVFAEVNSDKIYWQRNLDGTFSQFHSEKKAVGHCISTKAVGSDERADITHLYK
HQEGSEEERIAVETASRHGSKPDVYSKPMAEDVIVEVKLEGEGPRMGTDAKLSILVKNQS
SSPRRTTLHSQVAVMYYTGVLKGTIKKEEMPVELLPNEEKTIEWVLPYQQYQNELVDQAA
LMLTLSGRVSETQQVLANQTTFRLRTPDLIIAPLGDAVVGKEMAAKITFTNPLPRMLKGV
VFRVEGLGLQKGHEVVVGDVAAHSTVTLTEHFVPTQPGPRKLVASLDCKQLTQVHGVANI
VVLEQ
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtgagcgtttaacggtaagaggaacgtcggatgtggggcgtttccctggagca
gccccaccaaccagagtggagctgaccattcagaaagatgaaaaaaaacaggaagaggga
ggctgtcgccgctggttcaggaagatgtgcccgtgctgctgtaagcgccagaacagctcc
tcctatgatatcacagataaggtggaattggtcaaaccaccaactccggctgtcataccg
gtaccggaaccagtcaagcctaaacctgagaatggagaagcaagagagatggaagaaatt
aagttgtctgtggtttctgtggacctgctgagctccaagacggaccagaacagactggag
caccgcaccgacttatatcacggagaggacctgatcatccgcagaggacagcccttccac
atggagatggaactcaacaggcccttcaatgctgagaatgacaagctgcatctggacctg
aaaacaggtcccctccccatggtttccaaaggcacccatgtcatcattccactggtggat
aacccagaggataaacactggaaaggcaagattgtagagcagaacggcaacaagatcaag
ctgtccatcagttcgccagccactgctgtgtgtggcctgtacgggctcacggtgacaagt
agctcctcaaaggatgagccagcaactactcacgactgcagcaagaacatcgtcattctc
tttaacccttggtgtgaagaggacacagtgttcctggatgacgaggaggagaggaatgag
tacgttctgaatgacatcgggagaatttactatggcacagagaaacaaataggcgcccgc
acatggaactttgggcagtttcacgagggaatcctggaagcttgtctgtttatcctggag
aagagcgacatgcctgcgtctggtcgaggagatcctattaatatggtcagagtcatatct
gccatgataaacgctcaggatgactatggagtcctggtagggaactggtctggggattac
tctgatggagtctctccttctgcgtggagcagcagcgtggagatcttgaggaaatatcac
tccaccaatggaatacctgtgtcatatggacagtgttgggtcttctcgggggtcactacg
acagtgctgaggtgtcttggcatacctgcccgcagtgtgaccaacttccagtctgctcat
gatactgatgtatccctcactacagacgtctattttgatgagaatctggacccgatcgac
tacctcaatagtgattctgtctggaacttccacgtgtggaatgactgctggatggccaga
ccagacctgccccctggtaatggaggctggcaggctgttgactccactccccaggaaaca
agccagggcaccttccgctgtggccccgcctctctcaacgctatccgctcaggcgaagtc
tacctcaaacatgactcgccatttgtctttgctgaggtcaacagtgataagatctactgg
cagaggaacctggatggtactttcagccagtttcacagtgagaagaaagctgtcggccac
tgcatcagcactaaagcagtgggctctgatgagcgggcagacatcacacatctgtacaaa
caccaagaaggttcagaagaggaacgtattgctgtggagactgccagtcgtcatggcagc
aagccagatgtatactccaaacccatggcagaggatgtgattgtggaagtgaagctggag
ggcgaggggcccaggatgggtactgacgccaagctgagcatcctggtgaagaatcaaagc
tcgtcgcctcgtcggaccactctgcacagccaagtggctgtcatgtactacactggtgtg
ctcaagggcaccatcaagaaggaggagatgcctgtggagcttctgcccaatgaagaaaag
accattgagtgggtgctgccctaccagcagtaccaaaacgagctggtggatcaggcagct
ctgatgctgaccctgtctggaagagtcagtgagacccagcaagtattagccaaccagacc
accttcaggctccgtacacctgacctcatcatcgcgcctttgggagatgctgtggttggt
aaggagatggcagccaagatcaccttcaccaaccccctgccacgtatgctgaagggagtg
gtgttcagagtggagggcctgggtctgcagaagggccatgaagtggtcgttggtgacgtc
gccgctcactccacagtgacattgacggagcactttgtccccacccagcccggacccagg
aagctggtggcgtctcttgactgtaaacagctcacacaagtgcatggagtggctaacatc
gtcgttcttgagcagtga

DBGET integrated database retrieval system