KEGG   Larimichthys crocea (large yellow croaker): 104936957Help
Entry
104936957         CDS       T04659                                 

Definition
(RefSeq) coagulation factor XIII A chain-like
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
Enzymes [BR:lco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104936957
Cell adhesion molecules and their ligands [BR:lco04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     104936957
   VLA-9
     104936957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 745 aa AA seqDB search
MSDEIVTPTPSPSPSAPPVPTGPPPKVTNRGRTAVPIASSNSDTTDVPEFEPFGAPGPRG
FPPLTEFLDIWDVNMIKRPDEINRKQHHTVLYNSDNLIVRRGQEFQIKITFNRPYKPAED
KFALEFAIGSSPQFSKGTYIPVFPTSERQSTWTGRIINTNENMVTMGITPLASCIVGKYN
MYVAVMTPFGIRRTRRDSSRDLYILFNPWVADDAVFLDDERERDECVMTEMGIIYHGAHG
DIAERDWNYGQFNYGVLDACLYIMDRSDMPITNRGDPIKVTRKASAMMNSRDDEGVLVGN
WSGDYTYGVAPTSWTGSTEILTTYASSKMPVAYAQCWVYAAVFNTFLRCLGIPSRVVTNY
YSAHDNDGNLRTDIILDDTGRIDRNRTKDSIWNYHCWNECFMTRPDLPPGFGGWQVVDAT
PQETSDGMYRCGPASVQAIKHGHTCYPFDAAFVFAEVNSDVVFYSRSRDGTLELVKVNPT
HVGRLVLTKTPGDVSRRDITDQYKFPEGSTEERTTLEKAEEYGCKREKSNLPEADVDLVL
PTLEVSVGDDFELNMEFINRSDERRVVDAYISGSVVYYTGVTSSEFMLRSPRVTIGPNKS
VKELVVVESKSYMKHLVEQANLHFIATGKIKETGQIVTAMKVVPLHNPKLTVTVSEGGKV
SEEMTVTVQFKNPFSFDLEGVYIRMEGPGILMPKFKYYSLIPAGSSLTWTEFFTPHRAGS
TRMIAILDCPALRQVQGQASLTIEP
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgaaatcgtcactccgactccctctccctctccttctgcccctcctgttccc
accggaccacctcccaaggtgacgaaccgtggccgcaccgcagttcccatcgccagctcc
aactctgacacaactgatgtacccgagtttgagccatttggtgcaccgggcccaagagga
tttccacctctgactgagtttctcgacatctgggatgtcaacatgataaagcgtccagat
gagatcaacaggaagcaacatcacaccgtgttgtacaactctgataatctcatcgtccgt
cgaggacaagagttccagatcaagataaccttcaatcgcccctacaaacctgctgaagac
aagtttgctctggagtttgccattggttccagccctcagttcagcaagggcacctatatt
cctgtattccccaccagtgaacgtcagtccacctggactggacgcatcataaacaccaac
gaaaacatggtcaccatgggtatcactcctttggcaagctgcattgttggaaagtacaac
atgtacgttgctgtgatgacgcccttcggcatccgtaggaccagacgggacagcagcaga
gatctctacatcctcttcaatccatgggtggcagatgatgccgtgtttctggatgatgag
agagagagggacgagtgtgtgatgactgaaatggggatcatctaccacggtgcacacggc
gacatcgcagagagagactggaactatggacagtttaactatggagtcctggatgcctgt
ctgtacatcatggacaggtctgacatgccaatcaccaacagaggagaccccataaaggtg
accagaaaggcctctgctatgatgaactctcgtgatgatgaaggagtgctggtggggaac
tggagtggcgactacacctacggtgtggcacccacttcctggactggcagtacagaaatc
ctgactacctatgccagcagcaagatgcctgtcgcttatgctcagtgctgggtctacgct
gccgtcttcaacaccttcttgcgttgtttgggcatcccatcgcgggtcgttaccaactac
tactccgctcatgacaatgatggaaacctgagaactgacatcatcctggatgacacgggc
agaatcgaccgcaatcgcaccaaagactctatctggaactaccactgctggaatgagtgc
ttcatgaccaggccagaccttccacctggctttggaggctggcaggttgtggatgcaaca
ccacaggagactagtgatggcatgtacaggtgtggtcctgcatcagtccaggccatcaaa
catgggcacacatgctacccatttgatgctgcctttgtgtttgctgaggtcaacagcgat
gtggtgttttattcccggagtagagatgggactttggagctagtcaaagtgaacccgact
catgtaggccgcttggttttgactaaaacaccaggagatgtgtctcgccgtgacattacg
gatcaatacaagtttcctgagggtagtaccgaggagcggaccactctggaaaaagcagag
gagtatggctgtaaacgagagaagtccaaccttcctgaggctgacgtggatctggtcctg
cctaccctggaggtcagtgtgggcgacgacttcgagctgaacatggagttcataaatcgc
agtgacgaacgccgcgtcgtggatgcctacatcagcgggagtgtggtgtattacaccgga
gtcaccagctctgagttcatgttaaggagtcccagggtgacaattggcccaaacaaaagt
gtgaaggagttggtggtggtcgagtcaaagagctacatgaagcatcttgttgaacaggcc
aacctccatttcattgctactggaaagatcaaggagaccggccagatcgtcaccgccatg
aaagtcgtccccctgcacaatcccaaactcacagtcacggtgtctgagggaggtaaagtg
agtgaagagatgaccgtgactgtgcagtttaaaaaccccttctccttcgacctggagggc
gtctacattcgcatggaaggtcccggtatcctgatgcccaagttcaaatattacagtctg
atcccagcaggctcctccctgacctggaccgagtttttcaccccgcacagggctggcagc
accaggatgatcgctatcctggactgccctgctctcaggcaggtccaaggccaggcgtct
ctcaccattgagccctga

DBGET integrated database retrieval system