KEGG   Larimichthys crocea (large yellow croaker): 104937792Help
Entry
104937792         CDS       T04659                                 

Gene name
kmt5b
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lco00001]
  Amino acid metabolism
   00310 Lysine degradation
    104937792 (kmt5b)
Enzymes [BR:lco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104937792 (kmt5b)
Chromosome [BR:lco03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104937792 (kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 870 aa AA seqDB search
MKWLGESKNMVLNGRRHGNKLTSEQPVSQSQTRSQHSQRASLRHNKNRNRRCSRRFNAAS
LEAERRYVPSSGMTAKELCENDDLTTSLILDPYLGFQTHKMNTRFRPIKGRQEELKETIE
RFKKHDNLEKAFRALTSGDWSRNLFLHKTKAQEKLFKQHVFVYLRMFATDSGFEILPCNR
YSSEQNGAKIVATKEWKRNDKIEYLVGCIAELSESEENMLLRHGENDFSVMYSTRKNCAQ
LWLGPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGENNEFCECY
TCERRGTGAFKSKAGLPVEVPVINSKYGLRETDKRLNRLKKMGEGNRSSDSHSVGSHTDV
DSQEMPKTHQSARKRTSSSSGLKYKNRTQSRQTLSRALTTSCSKQGRVNNNRVPKRLKSQ
SKPSLSKVQLRSRRRGAEPKALAKGETCQLGLRDSKVSLCKSVTVKKEKDGQELVQQTLG
QRGCLTRHAAKENGNLSHVQSSEGSQCSTYRTRRSTRTLVKAQETAAGVKLEPSAMDGLS
PVPGGVVIKTEPADMEEYLRHGVGLEQPALDTGYSRRSSCTTRKRLTRLRTERTIKCEDS
YGEPFMPVAAGHAANFSDCGNVLLSFADRHRDYNGVANGSKSLRRDKGKSSCRSQDKGKK
KRRITRYDAQLILENNTGIPKLTLRRRRDSSSSKTNDANDPIGSSNLSASTVNSASSSKI
SIKFSKDHDKDKGSSYIAKLNNGFAPVVHSNSTKLKIQLKREDDARRISQTKADQMSYNG
DMGQGLEARNGGHRTQKVLSDHSSEEDDDDEEGEDDDEDDDDEDDDDDYYDDDFIPLPPA
KRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggcgaatccaagaacatggtattaaatggcagacgacacggaaacaag
ttgaccagcgaacaaccagtgagccagagccagacccgctctcagcattcacagcgagcg
tccctgcgccacaacaaaaacagaaaccgaagatgtagccgcaggtttaatgcagccagt
ctggaggcagagaggcgctatgtgccctcctccggaatgactgcgaaggagttgtgtgag
aacgatgatctgaccacgagcctcatcctggatccgtacctgggctttcaaactcacaaa
atgaacaccagatttcgaccaattaagggacggcaagaggagctgaaggagaccatcgag
cgcttcaagaaacacgacaacttggagaaagcgttcagagctttgacgtctggagactgg
tcccgaaatctttttctccacaagacgaaagctcaagaaaagctcttcaagcagcatgta
ttcgtgtatcttcggatgtttgccacggacagcgggtttgagattctcccttgtaatcgt
tactcatcagagcagaacggagctaaaattgtggcaacgaaagaatggaaaagaaatgac
aagatcgagtacctggtgggatgcatcgctgagctctcagagagcgaggaaaacatgctg
ctccggcacggcgagaacgacttcagcgtcatgtattcaacccgcaagaactgtgcgcag
ctctggctggggccggctgcgttcatcaatcacgattgtcggccaaactgcaagtttgta
tcgacagggcgggacacggcctgtgtgaaggttttgagggacattgaaccaggagaggaa
atctcatgttactacggagatggtttttttggggaaaacaatgaattttgtgaatgctat
acatgtgaacgacggggcacaggtgctttcaaatccaaagctggactgccagtggaagtg
ccggtgatcaacagcaagtacgggttgcgggaaacggacaaacgtctcaacaggctgaag
aagatgggcgaaggaaacaggagctcagatagtcactcagtaggctcccacaccgatgta
gactctcaggaaatgccaaaaacacatcaatctgccagaaaaagaacatcgtcatcatct
ggcctgaagtataaaaacaggactcaatccagacagactttgtcaagagcccttactacc
tcatgttcaaaacaaggtcgtgtaaacaataacagggtaccaaagagactaaaatcccaa
tccaagccttcactaagtaaagtccagttgcggagtcgcaggcggggtgcagagcccaag
gcgttggccaaaggtgagacttgccagctgggtctcagggactcaaaggtgtcgctgtgt
aaaagtgtcaccgtcaagaaggagaaggatggacaggagctggtgcagcagacactaggc
cagcggggctgcctcacccgtcatgctgccaaggagaacggcaatctatcgcacgtgcaa
agcagcgagggcagccagtgttcaacgtacagaactcgcaggtccacaaggacccttgta
aaagcccaggaaacggcagctggcgttaagctggagcccagtgctatggacggcttgagc
ccagtccctggtggagtggtcattaaaacggagccggccgacatggaggagtacctccgt
catggtgtaggactggagcagccggcgttagacaccggctacagcagaagaagctcgtgc
accacgcggaaacggctgacacggctcaggaccgagcggacgattaaatgcgaggactcg
tacggcgagccgttcatgccggtggctgctggccacgccgctaacttctcagactgtggt
aatgtgctgctgagcttcgccgaccgacacagggactacaatggggtcgccaacggcagc
aaatccctccgtagggacaagggcaagagtagctgccggtcgcaggacaaggggaagaag
aagcgccggatcacgcgatacgacgctcagttgatcctggagaacaacacgggcatcccc
aaactgacactccgccggcggagggacagcagcagtagcaagaccaatgatgccaacgat
cccattggctcctccaacctttctgcctctacggtcaactcggcctcttccagcaaaatc
agcatcaagttcagcaaggaccacgacaaggacaaaggcagctcgtacatagccaaactg
aataacggctttgcccccgtggtccacagcaactccaccaagctgaagatccagctgaag
agggaggacgatgctcggagaatatcccagacaaaggcggaccagatgtcctataacggg
gacatgggtcagggcctggaagccagaaatggtggacatcggacccaaaaggtcttgtcg
gaccattcgtcagaagaggacgacgacgacgaggaaggggaggacgacgatgaagatgac
gacgatgaagatgacgacgatgactactacgacgatgatttcattccacttcctccagca
aagcgcctccgactcattgtgggtaaagactccatagacatcgatatctcctccaggagg
agagaggatcagtctctgaggctcaatgcataa

DBGET integrated database retrieval system