KEGG   Lysobacter capsici: LC55x_2094Help
Entry
LC55x_2094        CDS       T04162                                 

Definition
(GenBank) glutathione S-transferase, C-terminal domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lcp  Lysobacter capsici
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lcp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LC55x_2094
Enzymes [BR:lcp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LC55x_2094
Transporters [BR:lcp02000]
 Other Transporters
  Pores ion channels [TC:1]
   LC55x_2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2317052..2317732
Genome map
AA seq 226 aa AA seqDB search
MIKVHHLNNSRSQRVLWLLEELELPYEVIRYQRDPKTMLAPKELRAIHPLGKSPVVELDG
QVLAESAAIIETLTERYDSEHRVSPPLQPMEGEERMRYRYWLHYAEGSAMPPLLLSLVFS
RLKQAPMPFFVKPVARGIADKALSSFVGPQLKLHLDYIESELGQRAWFAGERFTAADIQM
SFPVEAAMARAKDGQRPRMQAFVERIQARPAYQRALEKGGPYSLLS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtccatcacctcaacaattcccgctcgcagcgcgtgctgtggctgctggag
gaactggagctgccgtacgaggtgattcgctatcaacgcgatcccaagaccatgctggcg
ccgaaggaattgcgcgcgatccatccgctgggcaagtcgccggtggtcgaactcgacggc
caggtgctggccgaatcggccgcgatcatcgagaccctgaccgaacgctacgacagcgag
caccgggtgtcgccgccgctgcagccgatggagggcgaggagcgcatgcgttatcgctat
tggctgcattacgccgagggttcggcgatgccgccgttgctgctcagtctggtgttctcg
cgcctgaagcaggcgccgatgccgttcttcgtcaagccggtcgcgcgcggcatcgccgac
aaggcgctgtcctcgttcgtcgggccgcagttgaagctgcatctggattacatcgaaagc
gaactgggccagcgcgcgtggttcgccggcgagcgcttcaccgcggccgacatccagatg
agctttccggtcgaagcggcgatggcgcgggcgaaggacggtcagcgtccgcgcatgcag
gctttcgtcgagcgcatccaggcccggccggcctatcagcgcgcgctggagaagggcggg
ccgtattcgttgctgagctga

DBGET integrated database retrieval system