KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0185Help
Entry
Ldb0185           CDS       T00364                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
ldb00473  D-Alanine metabolism
ldb00550  Peptidoglycan biosynthesis
ldb01100  Metabolic pathways
ldb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ldb0185 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ldb0185 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Ldb0185 (ddl)
Enzymes [BR:ldb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ldb0185 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ldb01011]
 Precursor biosynthesis
  Amino acid ligase
   Ldb0185 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 GARS_A ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CAI97025
UniProt: Q1G7Q5
LinkDB All DBs
Position
154966..156054
Genome map
AA seq 362 aa AA seqDB search
MTKKTQVGLIFGGNSSEYEVSITSAGNIYKAIDKDKFDVHPIWITNSGYVASEADSYKVL
EEPGYMVEKNDKTANLSNLIELASRPELDVLFPIVHGNLGEDGVLQGLFRLIDKPFVGVD
VLAAAVTMDKEFTKILAQRAGVPVAKWVSIKRYEYEDAKNQKLSYDWVSGQLGTSNLFVK
PSNQGSSVGITHVTDDSNYAEALAEAFKYDDKVLVEEGIVGTEVETAVLGNDHPVVSGVG
QIINADNTWYSYENKYSTESTTTLQIPAQIPAETAEKVQENALKIYQITECSGMARVDSM
LRESDGEVIFNELNALPGFTNISMYPKLFEEAGISYPDLITRLIRLAEERYAHKKTLLRK
HD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaaacacaagttggtttgatttttggtgggaactcctccgaatacgaagtc
tcaatcacttcagccggcaacatctacaaggcaatcgacaaggacaagtttgacgtgcac
ccgatctggatcacgaactccggctacgtggccagtgaagctgattcatacaaggttctg
gaagagccgggctacatggtggaaaaaaatgacaagacggccaacctttctaacttgatc
gagctggcttcccggccggaactggacgtgctcttcccaatcgtccacggcaacctgggt
gaagacggggtcctgcagggcctcttccgcttgatcgacaagcctttcgtcggggttgac
gttttagcggcagccgtaaccatggacaaggaattcaccaagatcctggcccaaagagcc
ggcgtgccggtagccaagtgggtatctatcaagcgctacgaatatgaggacgccaagaac
caaaagctcagctacgactgggtcagcggccagctgggcaccagcaacctcttcgtcaag
ccgtccaaccagggttcttccgtcggcatcactcacgtaactgacgacagcaactacgct
gaagctttggccgaagcctttaagtacgatgacaaggttttggttgaagaaggaatcgta
ggcactgaagttgaaaccgccgttttgggtaacgaccacccggtagtttccggggtcggc
cagatcatcaacgccgacaatacttggtacagctacgaaaacaagtacagcacagaatca
accacgaccctgcagattccagcccagattccggcagaaaccgcggaaaaggtccaggaa
aacgccttgaagatctaccagatcactgagtgcagcggcatggcccgggttgactccatg
cttagagaaagcgacggggaagtcatcttcaacgaattgaacgccctgccaggctttacc
aacatcagcatgtacccgaagctgtttgaagaagccgggatttcttacccagacttgatc
acccgcttgatcaggctggctgaagagcgctacgcccacaagaagaccctcctgcgcaag
cacgactaa

DBGET integrated database retrieval system