KEGG   Lodderomyces elongisporus: LELG_02067Help
Entry
LELG_02067        CDS       T01116                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00020  Citrate cycle (TCA cycle)
lel00310  Lysine degradation
lel00380  Tryptophan metabolism
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
lel01200  Carbon metabolism
Module
lel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LELG_02067
  Amino acid metabolism
   00310 Lysine degradation
    LELG_02067
   00380 Tryptophan metabolism
    LELG_02067
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     LELG_02067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 5234466
NCBI-ProteinID: XP_001527238
UniProt: A5DXI0
LinkDB All DBs
AA seq 1014 aa AA seqDB search
MLRAFKSAIPRTQLLHSKSSIASTTTTTTTTTTSFRKVNYFATTTKRFLATDTFLQGNNS
NYVDEMYEAWRQDPSSVHASWNAYFKNIENSNVPPSQAFQAPPTLVPTVSGGAAGFVPGA
SGSANNQDVVTHLKVQLLVRAYQVRGHQKAKIDPLGISFGDSADTPKELTLEFYGFTEKD
LDKEITLGPGILPRFAQGDKKEMTLREIIKACEDLYCSSYGVEYVHIPSKTQCDWLRERI
EIPQPFKYSQDQKRQILDRLIWATSFESFLSTKFANDKRFGLEGCEAMVPAMKALIDTSV
EYGVEDIVIGMPHRGRLNMLSNVVRKPNESIFSEFSGSREFDEGSGDVKYHLGMNYQRPT
TSGKHVNLSLVANPSHLESEDGVVLGKTRAIQQYKNDVGEYKKAMSVLLHGDAAFAAQGV
VYETMGFANLPAYSTGGTIHVIVNNQIGFTTDPRFARSTLYPSDIAKSINAPIFHVNADD
VEACTFVFNLAAEWRATYHTDVIIDVVGYRKHGHNETDQPAFTQPLMYQEISKKKSVIDI
YAKQLIDEGTFTAEDIEEHKKWVWNILEESFSKAKDYEPTSREWLTTPWEDFKSPKELAT
EVLPHFPTAVDEATLKKIGDAISEVPEGFEVHRNLKRILNQRKKTVESGEGIDYATGEAL
AYGSLALEGYHVRVSGQDVERGTFSQRHAVLHDQKSESTWTPLSNLSDDQGVFSISNSSL
SEYGVLGFEYGYSLTSPDALVEWEAQFGDFANTAQVIIDQFIAGAESKWKQRSGIVLSLP
HGYDGQGPEHSSGRIERYLQLCNEDPRHFPTPEKLERQHQDSNMQVAYPTTPANVFHLLR
RQMHRQFRKPLILFFSKSLLRHPLARSELKDFTGDSGFQWIIEDVLGDKSEVKRVVLMTG
QVYTLLHKKRQQLEDKTTAFIKIEQLNPFPFAQLRDALNEYPNIEDLVWCQEEPLNMGAW
SFVVPRVESTLNETDKYKDLKLRYAGRDPSASVAAGSKAMHLAEEEQVLEEVFQ
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgcttagagctttcaagagtgctattccacgcactcaacttttacacagcaagtcatcc
attgcatcgacgacgacgacgacgacgacgacgacgacgagttttagaaaagtaaactac
tttgccacaaccaccaagagatttttggccactgatacttttttgcaaggaaacaactcc
aactatgttgacgagatgtacgaggcttggagacaagacccttcaagtgtccatgcctca
tggaatgcttacttcaaaaacattgaaaacagcaatgtcccaccatcacaagctttccaa
gcacctccaaccttggtaccaactgtttcaggtggtgccgccggttttgtccccggcgca
agcggctcagccaacaaccaagatgtcgttacccacttgaaggtgcaattgcttgttaga
gcttaccaagttagaggtcaccaaaaggccaagattgatcctttgggaatctcctttggc
gatagtgctgatactccaaaagagttgactttggaattttatggcttcaccgaaaaggac
ttggacaaggagatcactttgggtccaggtatcttgcccagatttgctcaaggagacaag
aaggaaatgaccttgagagaaatcatcaaggcctgcgaagacttgtactgttcctcttat
ggtgttgaatacgtccacattccatcaaagacccaatgtgactggttgagagagagaatt
gaaattccacaaccattcaaatactcacaagaccaaaagagacaaattttggaccgtttg
atttgggcaacctcatttgaatcattcttgtccactaaattcgccaacgacaagagattt
ggtttggaaggttgtgaagccatggttccagcaatgaaggccttgattgatacctcggtc
gaatacggtgttgaagatatcgttattggtatgccacacagaggtagattgaacatgttg
tccaatgttgtgcgtaaaccaaacgaatcaatcttttccgagttctctggctcaagagaa
ttcgatgaaggttcaggtgatgtcaagtaccacttgggtatgaactaccaaagaccaacc
acctcgggtaagcacgttaatttgtccttggttgccaacccatcacacttggaatctgaa
gatggtgttgttttgggtaagactcgtgctatccaacagtacaagaacgatgtaggcgaa
tacaagaaggccatgtcagtcttgttacatggtgacgccgcttttgctgcccaaggtgtc
gtttacgaaacaatgggttttgcaaacttgccagcatactccactggtggtaccattcac
gttattgtcaataaccaaattggttttaccactgatcctagatttgctagatcaaccttg
tacccatctgacattgccaagagtattaatgctccaatcttccacgtgaatgccgatgac
gttgaagcatgtacttttgtctttaacttggctgctgagtggagagcaacataccacact
gatgttatcattgatgttgttggttacagaaaacacggtcacaatgaaacagatcaacca
gcatttacccaaccattgatgtatcaagaaatctcgaaaaagaagtctgtcattgacatt
tatgctaagcaattgattgacgaaggtacttttactgcagaagatatcgaagagcacaag
aaatgggtatggaacatcttggaagaatcattctccaaggccaaggactacgagccaaca
tcaagagaatggttgactacaccatgggaagactttaagtcacctaaagaattggccacc
gaagtgttgccacactttccaactgcagtcgatgaagcaactttgaaaaagattggtgat
gctatttcagaagttcctgaaggctttgaagtccacagaaacttgaagcgtatcttgaac
caacgtaaaaagacagttgaatccggtgaaggtatcgactacgctactggtgaagctctt
gcttacggttctttggctcttgaaggttaccatgttagagtttcaggtcaagatgtcgag
agaggtactttttcacaaagacacgcggtcttgcatgaccaaaagtctgaaagtacatgg
acaccattgtccaacttgagcgatgatcaaggtgttttcagtatttcaaactcctcgttg
tctgagtatggtgtattgggatttgaatatggttactccttgacttcacctgatgcattg
gttgaatgggaagcacaatttggtgatttcgcaaacactgcacaagtcattattgatcaa
ttcattgccggtgccgagtctaagtggaagcaaagatctggtattgttttgtcattgcct
catggttatgatggccaaggtccagagcattcctctggtagaattgagagatacttgcaa
ttatgtaacgaagacccacgtcatttcccaactccagagaaattagaacgtcaacatcaa
gatagtaatatgcaagttgcatacccaactacaccagctaatgtcttccacttgttgcgt
cgtcaaatgcacagacaattcagaaagccattaattttgttcttttcaaagtcattattg
cgtcatccattggccagatccgagttgaaggatttcactggtgactctggtttccaatgg
atcattgaagatgtgcttggtgacaagtccgaggtgaagagggttgttcttatgactggt
caagtctacaccttgttgcacaagaagagacaacaattggaagacaagaccactgcattt
atcaagattgaacaattgaacccattcccatttgctcaattgcgtgatgcattgaatgag
tacccaaacattgaagatttggtatggtgtcaagaagagccattgaacatgggtgcttgg
tcttttgttgtgccaagagttgagtctacattgaatgaaaccgacaagtacaaggacttg
aagttgagatatgctggaagagacccaagcgcttcggttgctgccggttctaaggcaatg
catttggctgaagaagagcaagttttggaagaagtatttcagtaa

DBGET integrated database retrieval system