KEGG   Lodderomyces elongisporus: LELG_04376Help
Entry
LELG_04376        CDS       T01116                                 

Definition
(RefSeq) similar to glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lel  Lodderomyces elongisporus
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LELG_04376
Enzymes [BR:lel01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LELG_04376
Transporters [BR:lel02000]
 Other Transporters
  Pores ion channels [TC:1]
   LELG_04376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
AA seq 222 aa AA seqDB search
MALKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTIN
DPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQ
GQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALL
GWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPPKN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaaacctattaaactttatactgcacccacccccaatggatacaaaatcagt
atttttttagaggtcttgggtttggactatgaagtacaaaaatttgatctttccaagaat
gaaaccaaggaagactggtttgttaagctcaacccaaatggtcgtattcccactataaat
gatccaaatttcaaaggagttgatggcggattggttttgagtcaaactggtgcaatatta
cagtacctcgcagacacttatgataaagaacacaagtttagctatccagcaggcaccgct
gaatactacaagactttggagtacttgatattccaagtggcagaaaatggtcctatccaa
ggacaggctaatcattttgtctttgctgccaaggaaaaagtgccatatggtatcaataga
tacattacagatactaagagaatatatggtgtctttgaagacatcttgagcagaaacaag
gccaatgattctaaatacttggttggtgacagatacaccgttgctgattttgctttacta
ggctgggcataccgtttgtccaggttggaaatcgatatcaatcaatggcccttgttaggc
aaatggtatgattcattattgaagttacctgctgttcagaaagggttcgaagttcctcca
aagaactaa

DBGET integrated database retrieval system