KEGG   Lodderomyces elongisporus: LELG_05799Help
Entry
LELG_05799        CDS       T01116                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial precursor
  KO
K02358  
elongation factor Tu
Organism
lel  Lodderomyces elongisporus
Brite
Translation factors [BR:lel03012]
 Eukaryotic Type
  Elongation factors
   LELG_05799
 Prokaryotic Type
   LELG_05799
Mitochondrial biogenesis [BR:lel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    LELG_05799
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LELG_05799
  Exosomal proteins of breast cancer cells
   LELG_05799
  Exosomal proteins of colorectal cancer cells
   LELG_05799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 422 aa AA seqDB search
MFQRIQSLLPRRLALTSRPLLTRGYAAYNRTKPHVNIGTIGHVDHGKTTLTAAITKVLAE
KGYANFLDYGSIDRAPEERARGITISAAHVEYETDKRHYAHSDLPGHSDYIKNMITGASQ
MDGAIIVVAATDGQMPQTREHMLLARQVGIQNLVVYVNKVDTIDDPEMLELVEMEMRELL
SHYGFDGENTPVIMGSALCALEGKKPEIGVESINKLLDAVDEYIPTPERDADQPFLMPVE
DVFSISGRGTVVTGRVERGSLKKGEEVEIVGESSFKATSTGIEMFKKELDAAIAGDNCGI
LLRGVKRDEVKRGMVLAKPGTLKSHKKFLASIYVLTTEEGGRKTPFGEGYKPQLFFRTSD
ITADFSFPEGEGVDHSRMVMPGDNVEMVGTLIKLAPLELNQRFNIREGGKTVGTGMVTRI
IE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaagaattcaaagtctcttgccaagacgtttggcacttacctcccgtcctttg
ttgactagaggatacgctgcctacaaccgtaccaagccacacgttaacattggtactatt
ggtcacgttgatcatggtaaaaccaccttgactgctgccatcaccaaggttttggctgaa
aaaggttacgccaacttcttggactatggttcaattgatagagctccagaagaaagagca
agaggtatcaccatctctgctgctcacgttgagtacgaaaccgacaagagacactatgcc
cactctgatttgccaggtcactccgattatattaagaacatgattactggtgcctcccaa
atggacggtgctattattgttgttgctgccaccgatggtcaaatgccgcaaaccagagaa
cacatgttgttggctagacaagttggtatccaaaacttggttgtttatgttaacaaggtt
gacaccattgatgacccagagatgttggaattggttgaaatggaaatgagagaattgttg
tcgcactatggatttgacggtgaaaacaccccagtcattatgggttctgctttgtgcgct
ctcgaaggtaagaagccagaaattggtgttgagtccatcaacaagttgttggatgctgtt
gacgaatacattcctaccccagaaagagatgctgaccaaccattcttgatgccagttgaa
gatgtcttttccatttccggtagaggtactgttgttaccggtagagtcgagagaggttca
ttgaagaagggtgaagaagttgagattgttggtgaatccagcttcaaggctacttcaacc
ggtattgaaatgttcaagaaggaattggacgctgctattgctggtgacaactgtggtatc
ttgttgagaggtgtcaagagagacgaagtcaagagaggtatggttttggccaagccaggt
actttgaagtcccacaagaaattcttggcatcgatctatgtcttgaccactgaagaaggt
ggtcgtaagactccattcggtgaaggttacaagccacaattgttctttagaacctccgac
atcactgctgactttagcttcccagaaggtgaaggtgttgaccactctagaatggttatg
ccaggtgacaatgtcgagatggttggtactttgatcaaattggcaccattggagttgaac
caacgtttcaacatcagagaaggtggtaagactgttggtaccggtatggttaccagaatc
atcgagtaa

DBGET integrated database retrieval system