KEGG   Lysobacter enzymogenes M497-1: LEN_1927Help
Entry
LEN_1927          CDS       T04598                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lem  Lysobacter enzymogenes M497-1
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lem00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LEN_1927
Enzymes [BR:lem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LEN_1927
Transporters [BR:lem02000]
 Other Transporters
  Pores ion channels [TC:1]
   LEN_1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2274251..2274928
Genome map
AA seq 225 aa AA seqDB search
MIKVHHLNNSRSQRVLWLLEELELPYEVIRYQRDPKTMLAPPELRAIHPLGKSPVVELDG
QVLAESAAIIETLCERYDSGHTVSPPPQPLDGEERRRYRYWMHYAEGSAMPPLLLSLVFA
RIRSAPMPFFAKPVARGIADKAMRAFVGPQLALHLGYIESELGQREWFAGDRFTAADIQM
SFPVEAATARAIGERPRMQAFVERIRARPAYQRALEKGGPYSLLS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtccaccacctcaacaattcccgctcccagcgcgtgctgtggctgctggag
gagctggaactgccttacgaggtgatccgctaccagcgcgatcccaagacgatgctggcg
ccgccggagctgcgcgcgatccatcccctgggcaagtcgccggtggtggagctggacggg
caggtgctggccgagtcggcggcgatcatcgagaccttgtgcgagcgctacgacagcggc
cacacggtttcgccgccgccgcagccgctggacggcgaggagcgccggcgttaccgctac
tggatgcactacgccgagggctcggcgatgccgccgctgctgctgagcctggtgttcgcg
cggatccgctcggcgccgatgccgttcttcgccaagccggtggcgcgcgggatcgctgac
aaggccatgcgcgccttcgtcgggccgcagctggcgctgcacctgggctatatcgaaagc
gagctgggccagcgcgaatggttcgccggcgatcgcttcaccgcggccgatatccagatg
agcttcccggtcgaggccgcgaccgcgcgcgccatcggcgagcggccgcgcatgcaggcc
ttcgtcgaacgcatccgcgcgcggccggcgtaccagcgggcgttggagaagggcgggccg
tattcgttgttgagttga

DBGET integrated database retrieval system