KEGG   Leptolyngbya sp. NIES-3755: LEP3755_14800Help
Entry
LEP3755_14800     CDS       T04199                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
len  Leptolyngbya sp. NIES-3755
Pathway
len00620  Pyruvate metabolism
len00680  Methane metabolism
len00710  Carbon fixation in photosynthetic organisms
len01100  Metabolic pathways
len01120  Microbial metabolism in diverse environments
len01200  Carbon metabolism
Module
len_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:len00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LEP3755_14800
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    LEP3755_14800
   00680 Methane metabolism
    LEP3755_14800
Enzymes [BR:len01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LEP3755_14800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAU10987
UniProt: A0A0S3U0E0
LinkDB All DBs
Position
complement(1572599..1575643)
Genome map
AA seq 1014 aa AA seqDB search
MSSTRPSSDEFSTSLTTASEDVTAMMSDLFLRHRLRIVEDLWEAVLRQECGQELVDLLNQ
LRRMCSPEGQATTFTGSEVLQVVEKLDLNEAIRAARAFALYFQLINIVEQHYEQRDQQLQ
YRMAREGHGQPDPKHERQAYATEEDAGRPEADFLERSLHEAASRREIGTFHWLFPRLKQL
NVPPQLIQKLINQLDVWLVFTAHPTEIVRHTIRDKQRRIAKILRQLDSVEDSLKAIGLSS
SWEADSLRDQLTEEIRLWWRTDELHQFKPTVLDEVDHALHYFREVIFDAIPHLYQRLEEA
VHGSFPKMQMPRRNFCQFGSWVGADRDGNPSVTPQVTWQTACYQRRLVLERYVNSIQSLS
ELLSLSLHWSDVLPDLLESLEQEQQRMPEVYDRLSIRFRQEPYRLKLAYICKRLENTLER
NQILSNIDGLQQEMPEYDETKIYRSGDDFLTELRLIQSNLAATGLSCRDLDHLICQVEIF
GFNLAHLDIRQESPRHSETMNEVVEYLQVLPKAYNDMSEEERCQWLISELKTRRPLIPSE
LPFSDRTREAIATFRMVRKLQQEFGIDICRTYIISMSHDVSDLLEVLLFAKEAGLYDPAT
GFGTIQVVPLFETVEDLQKAPGIMRGVFDLPFYKALLAGGFESIGVTTALQEVMLGYSDS
NKDSGFLSSNWEIHKAQQALQSIADEHGVVLRIFHGRGGSVGRGGGPAYEAILAQPGHSV
NGRIKITEQGEVLASKYSLPELALYNLETVTTAVIQGSLLQNKFDEIAPWQQVMEELAAR
SRKHYRSLIYEQPDFIDFFHQVTPIEEISQLQISSRPARRGGKKDLASLRAIPWVFSWTQ
SRFLLPSWYGVGTALQGFLDEAPEKHMQLLRHFYFKWPFFKMAISRVEMTLSKVDLQIAS
HYVDELTQPEDRERFAPVFEQIRNEYLLTRELVLTITGHNRLLDGDPELQRSVQLRNGTI
VPLGFLQVSLLKRLRQHKTLAASGVVRSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgacccgaccttcttctgacgaattttcgaccagtctcactacggcttctgaa
gatgtcaccgcaatgatgtctgatctctttttgcggcatcgtctcagaattgtagaggat
ctctgggaagctgtattgcgccaagaatgtggacaagaattggtggatctgctgaatcag
ttgaggcggatgtgctctccagaaggtcaagcaaccacgtttactggctcagaagtgctg
caagtcgtggaaaagctcgatttgaatgaagcgattcgagccgctcgtgcgtttgcactt
tattttcagttgatcaatattgttgaacagcattacgaacagcgagaccaacagttacag
tatcggatggcacgagagggacacggacagcctgatccgaaacatgaacggcaagcttat
gccacagaggaagatgcaggacgaccagaggcggactttttagagcggagtctgcatgag
gcggcttctcggcgggaaatcggcacgttccactggctgtttcctcggctcaaacagttg
aatgttccacctcagttaattcaaaaattgatcaatcagttggatgtgtggcttgttttt
acggctcacccgactgagattgtgcgccatacgattcgagataagcagcgacggattgcg
aaaattctgcgccagttggacagcgtggaagatagcttaaaagcgatcgggctttcttca
tcatgggaagcagattctctacgcgatcagttaaccgaagagattcgcctctggtggcgc
accgatgaactgcaccaattcaagccaacggttctcgatgaagtggatcatgcgctgcat
tacttccgagaagtgatttttgatgcgattcctcatctgtaccagcgtttggaagaagcc
gttcatggatcgtttccaaagatgcagatgccgcgtcggaatttctgtcagttcggatct
tgggtgggagccgatcgagatggtaatccgtctgtaactccgcaagtcacttggcaaacc
gcttgctatcagcgtcgtctggttctagaacgctatgtcaattcgattcaatcattgagc
gaattgctgagtttatcgctgcactggagtgatgttctacctgatttgttggaatcgttg
gaacaagagcaacagcgaatgccagaggtatacgatcgcttatcgatccgattccgtcaa
gagccgtatcgactcaagttagcttacatttgcaagcggttagaaaacacactggagcgt
aaccaaattctctcgaacatcgacgggctgcaacaagaaatgcccgaatacgatgaaacg
aaaatttatcgatcgggtgatgattttctcactgaactgcgattgattcaaagcaatctg
gcggcaaccggattaagctgtcgcgatttggatcatctgatctgccaagtcgaaattttt
ggattcaacctagctcacctcgacattcggcaagaaagtccgcgtcattcagaaaccatg
aatgaagtggtggaatatcttcaagttctgccgaaagcctacaacgacatgagcgaagaa
gaacgatgtcaatggttgattagcgagctaaaaactcgcagacctttaattccttctgaa
ctgccattctccgatcgaactcgtgaagcgatcgcgacttttcgcatggttcgcaagctt
caacaggaatttggcatcgatatctgtcgcacctacatcattagtatgagtcacgatgtc
agtgacttactcgaagtgctgttgtttgctaaggaagcaggattgtatgatccagcaacc
ggattcggaaccattcaagtcgtgcctttgtttgaaaccgtagaagacttgcaaaaagca
cctggcattatgcgcggcgtgtttgatttgccattctacaaagcactattggcaggtgga
tttgaatcgatcggtgtcacaactgcgctccaagaagtcatgctgggctattcagatagc
aacaaagattcgggtttcttgagtagtaactgggaaattcacaaagcgcagcaagctctt
caaagtattgccgatgaacacggggttgtgctgcggattttccacggtcgcggcggttct
gtgggtcgagggggcggtccggcttatgaagcaattttggcgcaacctggacatagtgtg
aatggtcggatcaaaattacagaacaaggcgaagtacttgcttctaagtattcgttacca
gaacttgcgctgtataacttagaaaccgttacaactgctgtgattcaaggaagcttatta
cagaataagttcgatgagattgcaccttggcagcaagtcatggaagaattggcggctcga
tcgcgcaaacactatcgctctctgatctacgagcaacctgattttattgacttcttccac
caagtgaccccgatcgaggaaatcagtcagcttcaaatcagttctcgtcctgcacgtcga
ggtggcaaaaaagatttagcaagtctcagagccattccttgggtctttagctggacacaa
agccgattcctattaccgtcctggtatggagttggaactgcgctgcaaggtttcttagat
gaagcgcctgaaaaacacatgcagcttctacgacatttctacttcaaatggcctttcttc
aaaatggcaatttccagagttgaaatgacgctttctaaagtcgatttgcagattgccagt
cactatgtcgatgaactcacacaacctgaagatcgagagcggtttgctccagtattcgag
cagattcggaatgaatatctgctaactcgtgagctagttctgacgattaccggacacaat
cgattgttagatggcgatccagaacttcagcgatcggtccagttacgcaacgggacgatc
gtgcctctcggattcctccaggtgtcgttgttgaaacgattacgacaacataaaaccctc
gccgcctccggagtggtgcgatcgcgctacagcaaaggtgaattactacgcggtgcattg
ctcacgattaacggaatcgctgcgggaatgcggaatacaggttaa

DBGET integrated database retrieval system