KEGG   Leptolyngbya sp. NIES-3755: LEP3755_29110Help
Entry
LEP3755_29110     CDS       T04199                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
len  Leptolyngbya sp. NIES-3755
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:len00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LEP3755_29110
Enzymes [BR:len01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LEP3755_29110
Transporters [BR:len02000]
 Other Transporters
  Pores ion channels [TC:1]
   LEP3755_29110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3005843..3006481
Genome map
AA seq 212 aa AA seqDB search
MLTLYHHPLSANSRRVWILLLEKNLPFELVALKLDGDQLQPKFLELNPFHQVPVLVDDGF
RVVESLAILDYLEAKYPTPPMLPIAPQAVGVVRMVQLLTLTALRPALIPLTYQMLGTKTY
EPQALETARQEVETVFKFFEQLLGKQRYFGGEALTLADITASTSVLTCHHLDISLQPFAK
LQAWCERLLQRSAWQTTEPSAETIAAFKQARS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccctttatcatcatccgctatccgctaactctcggcgagtttggattctgttg
ctagagaagaatcttccctttgagctagttgcgctcaaacttgatggcgatcagttacag
cccaaatttctagagctgaatccctttcatcaggttcctgtccttgtggacgatggattt
agagtggttgaatctctcgccattctcgattacctagaagcaaaatatcccacgcctccg
atgctaccgatcgcacctcaagcagtgggagtcgtgcggatggtacaactcttgaccctg
actgctctaagacctgctctcatacccttgacgtaccagatgcttggcacgaaaacttac
gaacctcaagcgctagagactgcaagacaagaagtagaaaccgtgttcaagttctttgaa
caattgttaggcaaacagcgttactttggcggtgaagcattaacactcgcagacattaca
gcgagtacgtctgttctgacctgtcatcatcttgacatttcattgcaaccctttgcaaag
ctacaagcttggtgtgaacgactgctccaacgttcagcatggcagaccacagagccaagt
gcagaaactattgccgcattcaaacaagcccggagttga

DBGET integrated database retrieval system