KEGG   Lysobacter enzymogenes C3: GLE_1570Help
Entry
GLE_1570          CDS       T04371                                 

Definition
(GenBank) dipeptidyl carboxydipeptidase family
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lez  Lysobacter enzymogenes C3
Brite
Enzymes [BR:lez01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     GLE_1570
Peptidases [BR:lez01002]
 Metallo Peptidases
  Family M2
   GLE_1570
Exosome [BR:lez04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GLE_1570
CD molecules [BR:lez04090]
 Proteins
  GLE_1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1701166..1703193)
Genome map
AA seq 675 aa AA seqDB search
MKPVRALLALGVAAAVIGLAGCKKEPATAPSATAPAAAPAGETADQFIARVNDEYKKMYP
EMTAAQWLSSTYINDDSQLLSAKANERYLGQLNSWIEQSKKFEGQQMSPATARAIQLLKI
GTAMPAPKDPARLAELTQIATRMEGMYGSGSYCSGPGETDCRQLGDLEDVLRNSRDYDAQ
LDAWKGWHTISKPMRKDYTRFVELVNEGARNLGYADTGELWRSGYDMSPAELSAETDRLW
GQVKPLYEQLHCYTRSRLETKYGNDKGQVAGGLLPAHLLGNMWQQDWGNLWDVLAPYSEQ
QAGSLDINAALARQYQQILDAQQNKAGERDAAGQAQVEVDAQLANAKRMTERAQDFYVSL
GMPKLPDSYWAKTQFVKPRDRDVVCHASAWDMNMSGDVRTKMCIKPNEEDFTTIYHELGH
VYYYLAYNKQPPLFQTGAHDGFHEAIGDTIVLAMTPKYLSSVGMVANPQQSQEALINAQM
RMALAKVSFLPFGLMIDRWRWGVFDGSIKPDQYNKAWWDLKARYQGVAPVEARGEDFFDA
GAKYHVPGNTPYTRYFLSHILQFQFYKSLCDAAGYKGPLYECSFYGNKAAGAKFEAMLSK
GASQPWQQTMKELTGGEKMDASAVLEYFAPLQTWLKQQNEGKSCGWQASAAGAAAPASPA
KPAAKSEAPAKPAKG
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtccgcgccttgttggcgctcggcgtcgctgcggccgtgatcggcctggcc
ggctgcaagaaggaacccgccaccgccccgagcgccactgcgccggccgccgcgccggcc
ggcgagaccgcggatcagttcatcgcccgggtcaacgacgaatacaagaagatgtatccg
gagatgaccgccgcgcagtggctgtcctcgacctacatcaacgacgacagccagctgctg
tcggccaaggccaacgagcgctacctcggccagctcaacagctggatcgagcagtccaag
aagttcgagggccagcagatgtcgccggccaccgcgcgcgcgatccagctgctcaagatc
ggcaccgcgatgccggcgccgaaggatccggcgcggctcgccgagctgacccagatcgcc
acccgcatggaaggcatgtacggttcgggcagctactgcagcggccccggcgaaaccgac
tgccgccagctcggcgacctcgaagacgtgctgcgcaacagccgcgactacgacgcccag
ctcgacgcctggaagggctggcataccatctccaagccgatgcgcaaggactacacgcgc
ttcgtcgaactggtcaacgaaggcgcgcgcaacctcggctacgccgacaccggcgagctg
tggcgctcgggctacgacatgagcccggccgagctgtcggccgagaccgaccgcctgtgg
ggccaggtcaagccgctgtacgaacagctgcactgctacacccgctcgcgcctggaaacc
aagtacggcaacgacaagggccaggtcgccggcggcctgctgcccgcgcacctgctcggc
aacatgtggcagcaggactggggcaacctgtgggacgtgctggcgccgtacagcgagcag
caggccggtagcctcgacatcaacgccgcgctggcgcgccagtaccagcagatcctcgac
gcgcagcagaacaaggccggcgagcgcgacgcggccgggcaggcgcaggtcgaggtcgac
gcgcagctcgccaacgccaagcgcatgaccgaacgcgcgcaggacttctacgtctcgctc
ggcatgcccaagctgcccgacagctattgggccaagacccagttcgtgaagccgcgcgac
cgcgacgtggtctgccacgccagcgcctgggacatgaacatgtccggcgacgtgcgcacc
aagatgtgcatcaagccgaacgaagaagacttcaccacgatctaccacgagctcggccac
gtctattactacctggcctacaacaagcagccgccgctgttccagaccggcgcgcacgac
ggcttccacgaggccatcggcgacaccatcgtgctggcgatgacgccgaagtacctgtcc
tcggtcggcatggtcgccaacccgcagcagagccaggaagcgctgatcaacgcgcagatg
cgcatggccctggccaaggtctcgttcctgccgttcgggctgatgatcgaccgctggcgt
tggggcgtgttcgacggctcgatcaagcccgaccagtacaacaaggcgtggtgggatctg
aaggcgcgctaccagggcgtggcgccggtggaggcgcgcggcgaggacttcttcgacgcc
ggcgccaagtaccacgtgccgggcaacaccccgtacacgcgctacttcctctcgcacatc
ctgcagttccagttctacaagtcgctgtgcgacgcggccggctacaagggcccgctgtac
gagtgcagcttctacggcaacaaggccgccggcgccaagttcgaggcgatgctgagcaag
ggcgcgagccagccgtggcagcagacgatgaaggaactgaccggcggcgagaagatggac
gcctcggcggtgctggagtacttcgcgccgctgcagacctggctcaagcagcagaacgaa
ggcaagagctgcggctggcaagcgtcggcggcgggcgccgcggcgccggcatcgccggcc
aagccggcggcgaagagcgaagcgccggccaagccggccaagggctga

DBGET integrated database retrieval system