KEGG   Laceyella sp. FBKL4.010: C1X05_04900Help
Entry
C1X05_04900       CDS       T05304                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lfb  Laceyella sp. FBKL4.010
Pathway
lfb00020  Citrate cycle (TCA cycle)
lfb00480  Glutathione metabolism
lfb01100  Metabolic pathways
lfb01110  Biosynthesis of secondary metabolites
lfb01120  Microbial metabolism in diverse environments
lfb01130  Biosynthesis of antibiotics
lfb01200  Carbon metabolism
lfb01210  2-Oxocarboxylic acid metabolism
lfb01230  Biosynthesis of amino acids
Module
lfb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lfb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lfb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C1X05_04900
  Metabolism of other amino acids
   00480 Glutathione metabolism
    C1X05_04900
Enzymes [BR:lfb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C1X05_04900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AUS08233
UniProt: A0A2I7SQS4
LinkDB All DBs
Position
949788..951083
Genome map
AA seq 431 aa AA seqDB search
MAQFKNLVAPAHGEKITVEGGKLNVPDRPIIPFIEGDGTGPDIWRAAKRVLDSAVEKAYN
GKKEIAWFEVFAGEKAYNQFGEWLPEDTLEAVREYLVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYFEGVPSPVKRPQDVDMVIFRENSEDIYAGIEWEAGSEEVKKVVRFLQ
EEMGVKKIRFPETSGIGIKPVSSEGTERLVKAAIEYAIRHKRKSVTLVHKGNIMKFTEGA
FKNWGYEVAERDYKDHVFTWAQYDRIKAEQGTEAADQAQAAAIEAGKIIVKDVIADAFLQ
QILTRPAEYDVIATLNLNGDYVSDALAAQVGGIGIAPGANINYVSGHAIFEATHGTAPKY
AGLDKVNPGSVILSGVLMLEHLGWQEAADLIYQAMSKTITDKTVTYDFARLMDGATEVKC
SEFADHLIKNM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatttaaaaatcttgtagctcctgcacacggggaaaaaataacggtagaaggc
ggcaaattgaacgtaccagatcgcccgatcattccattcattgaaggggatggcaccggt
ccggatatttggcgtgctgctaaacgggttctcgattccgcagtcgaaaaagcatataat
ggaaagaaagagattgcctggtttgaagtgtttgccggagagaaagcgtacaaccaattc
ggcgaatggttgccagaagatacgcttgaagctgtgcgcgaatatttggtagcgatcaaa
gggccgctcacgacgccagttggcggaggtatccgctctttgaatgtggctttgcgccaa
gagttggatctgtatgtgtgcttgcgccccgtccgttatttcgaaggggttccttctcca
gtgaaacggccgcaagatgtggacatggttatcttccgtgaaaactccgaagacatttat
gccggtattgagtgggaagccggatcggaggaagtgaagaaagtggttcgtttcctgcag
gaggaaatgggcgtgaagaagattcgcttccctgaaacctctggcatcggtatcaaacct
gtgtcgagcgaagggacagagcgtctggtgaaagcggcgatcgagtatgcgattcgccac
aagcgcaaaagcgtgaccttggtacataaaggaaacattatgaagtttaccgaaggggcg
tttaaaaactggggctatgaagtggccgagcgggattacaaagaccatgtgttcacttgg
gctcaatatgaccgcatcaaggctgaacaaggcaccgaagcggcagatcaagcgcaggcg
gctgcgattgaagcgggcaagattatcgtgaaagacgtgattgccgacgcattcctgcaa
caaatcctgacccgaccggctgaatacgatgtgatcgccaccctgaacctcaacggagac
tatgtgtccgatgcgctggcggcacaagtgggcggcattggtatcgcgccgggagccaat
atcaactatgtgtcggggcacgccatctttgaagcaacccatggaaccgcccccaaatac
gcaggcttggacaaagtgaatccaggttctgtgattctctctggcgtcctcatgctggaa
catctcggttggcaagaagcggctgacctgatctatcaagcgatgagcaaaacgattaca
gataaaacggtaacgtatgacttcgcccgcttgatggatggggctacggaagtgaaatgc
tccgagtttgccgaccatctgatcaaaaatatgtaa

DBGET integrated database retrieval system