KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_236045Help
Entry
LOTGIDRAFT_236045 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00240  Pyrimidine metabolism
lgi00983  Drug metabolism - other enzymes
lgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LOTGIDRAFT_236045
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    LOTGIDRAFT_236045
Enzymes [BR:lgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LOTGIDRAFT_236045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 Cytochrome_C7 ATPase_2
Motif
Other DBs
NCBI-GeneID: 20250038
NCBI-ProteinID: XP_009064405
JGI: 236045
UniProt: V3ZR47
LinkDB All DBs
Position
Unknown
AA seq 253 aa AA seqDB search
MSNIAPANKNIICSSMGKVKKGEIQIIFGPMFSGKTTELVRRLKRYQIANYNVLVIKYSK
DTRYDDNDIATHDRQTLPAVSTEKLYDLKSKAQQFEVIGIDEGQFFPDVVKFCNEMANAG
KTVIVAALDGTFQKQGFGNTLELVPLAEHIIKLSAVCMMCYNEAYFTKRKSNETAVEVIG
GADKYLAVCRSCHESSPVKQSPQKRSPFKERSNTPQINTLSIKTDTTRKLFDSSQHKENS
TFRKNFCFESCNA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatatagcaccagcaaacaaaaatatcatttgttcctcaatgggaaaagttaaa
aaaggagaaattcagatcatatttggtcccatgttctcgggaaaaacgactgaattagta
agaagattaaagagatatcagatagccaattacaatgttttagttattaaatattctaaa
gatacaagatatgacgacaatgatatagctacacatgacagacaaactttaccagctgta
tcaactgaaaaactatatgatttaaaatctaaagctcaacaatttgaagtcattggtatt
gatgaaggccaattttttcctgatgtagtaaaattctgtaatgagatggccaatgctggt
aaaacagtcatagttgcagcattagatggtacctttcaaaaacagggatttggtaacacc
ttagaattagtacctttagcagaacatataattaaattatcagcagtttgtatgatgtgt
tataatgaagcctactttactaagagaaagagcaatgaaacagctgtagaagtgataggt
ggtgctgataaatacttagcagtatgtcgtagttgtcacgaatcatccccagtcaaacag
tcaccacagaaacgatctccatttaaagaacgttccaatacaccgcaaattaacactttg
tctattaaaacagataccacacgcaaactatttgatagttcccaacacaaagaaaactcg
acatttcgaaagaatttttgttttgagagctgtaatgcttag

DBGET integrated database retrieval system