KEGG   Lactobacillus ginsenosidimutans: ABM34_11035Help
Entry
ABM34_11035       CDS       T03990                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lgn  Lactobacillus ginsenosidimutans
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lgn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABM34_11035
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABM34_11035
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ABM34_11035
Enzymes [BR:lgn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ABM34_11035
Peptidoglycan biosynthesis and degradation proteins [BR:lgn01011]
 Precursor biosynthesis
  Amino acid ligase
   ABM34_11035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2209965..2211023
Genome map
AA seq 352 aa AA seqDB search
MKIVVLSGGKSTERNVSLSSGVKISNALRSKGYEVANIDSFLGIDIEEDQIDSLFKTEAE
DETKLIIDDEVLTDEKIEALRTDGTRGLLGKNVLKVCQHADMVYLGLHGEDGENGKMQAV
LDVFGIRYTGSGTLSSAVTMDKKFSKEVFVQNKIKTAKFIATKTSKITKDEIPFRFPMVV
KPSNGGSSVGTHIINDESELQAMVADALKFDKEALIEEYIDGREFSVAVVDGQVLPAIEV
VVDTGWYDFQHKFTENTTTHFMTPPENLDEDIHLEMQEVALQTFEALSMTSYGRVDFLVR
DRDIYVMEANTLPGMTPRSLMPREAEAVGISYPDLCDKIIKSKMRYYDELEK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttgttctctcaggtggtaaaagtactgaaagaaacgtttctttgtcttca
ggtgtcaaaatctcaaacgcccttcgcagcaagggatatgaagttgccaatattgattca
ttcttaggaattgatattgaagaagaccaaatagattctttatttaaaactgaagcagaa
gatgaaacaaaattgatcatcgacgacgaagttttaacagatgaaaaaatcgaggcattg
cgtacagacggaactcgtggtttgttaggtaaaaatgttttgaaagtttgccaacatgct
gacatggtttacttaggtctacacggcgaagatggcgaaaacggtaaaatgcaagctgtt
cttgatgtatttggtattcgctacactggtagtggaacattatcatctgctgttactatg
gacaagaaattctctaaagaagttttcgttcaaaacaaaattaagactgctaagtttatt
gccacaaaaacaagcaagattactaaagatgaaattccattccgtttcccaatggtggtt
aaaccatcaaacggtggttcaagtgttggtacacatatcatcaacgatgaatcagaatta
caagcgatggttgctgacgctttgaaattcgacaaggaagccttgattgaagaatatatt
gatggtcgtgaattttctgttgctgttgttgatggacaagtgttaccagccattgaagtt
gttgttgatactggttggtatgatttccaacataaatttacagaaaacactacgacacat
ttcatgactccaccagaaaatcttgatgaagatattcatttggaaatgcaagaagttgct
ctacaaacttttgaagctttaagtatgactagttatggtcgtgttgacttcttagttcgt
gatcgtgatatctatgtaatggaagcaaatacacttccaggaatgacacctcgttcattg
atgcctcgtgaagcagaagctgtaggtatcagttacccagatctttgcgataaaatcatt
aagagcaagatgcgttactatgatgaattagaaaaatag

DBGET integrated database retrieval system